Recombinant Human BP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-98 of Human DLX4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEK

Protein/Peptide Type
Partial Recombinant Protein
Gene
DLX4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BP1 Protein

  • Beta protein 1
  • BP1distal-less homeo box 7
  • distal-less homeobox 4
  • DLX7distal-less homeo box 9
  • DLX8DLX9
  • homeobox protein DLX-4
  • Homeobox protein DLX-7
  • Homeobox protein DLX-8

Background

DLX4 - distal-less homeobox 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF674
Species: Hu
Applications: WB, Simple Western, Neut
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-89719
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
H00001748-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for BP1 Partial Recombinant Protein (H00001748-Q01) (0)

There are no publications for BP1 Partial Recombinant Protein (H00001748-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BP1 Partial Recombinant Protein (H00001748-Q01) (0)

There are no reviews for BP1 Partial Recombinant Protein (H00001748-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BP1 Partial Recombinant Protein (H00001748-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BP1 Products

Bioinformatics Tool for BP1 Partial Recombinant Protein (H00001748-Q01)

Discover related pathways, diseases and genes to BP1 Partial Recombinant Protein (H00001748-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BP1 Partial Recombinant Protein (H00001748-Q01)

Discover more about diseases related to BP1 Partial Recombinant Protein (H00001748-Q01).
 

Pathways for BP1 Partial Recombinant Protein (H00001748-Q01)

View related products by pathway.

PTMs for BP1 Partial Recombinant Protein (H00001748-Q01)

Learn more about PTMs related to BP1 Partial Recombinant Protein (H00001748-Q01).
 

Research Areas for BP1 Partial Recombinant Protein (H00001748-Q01)

Find related products by research area.

Blogs on BP1.

BRCA1 - A Critical Tumor Suppressor Gene in Women
Breast cancer 1, early onset (BRCA1) is a well-known tumor suppressor gene that was originally discovered due to its link with early-onset breast and ovarian cancer in women. The BRCA1 protein contains the following domains: RING finger, RAD51-interac...  Read full blog post.

BP1 Antibodies, Beta Globin and Breast Cancer: Today's post is brought to you by the letter 'B'
The transcription factor beta protein 1 (BP1) is a member of the homeobox gene family and the distal-less subfamily. Expression of BP1 is highly tissue-specific and developmentally restricted. Among different human tissues, BP1 is found to be highly e...  Read full blog post.

Customers Who Bought This Also Bought

BP1 Antibody
NB100-481
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX4