BNIP3L Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

BNIP3L Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BNIP3L.
  
  

  Source: E. coli

  Amino Acid Sequence: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BNIP3L
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88558.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BNIP3L Recombinant Protein Antigen

• Adenovirus E1B19K-binding protein B5
• BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A
• BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
• BCL2/adenovirus E1B 19-kd protein-interacting protein 3a
• BCL2/adenovirus E1B 19kDa interacting protein 3-like
• BNIP3a
• BNIP3H
• BNIP3L
• Nip3L
• NIP3-like protein X
• Nix
• NIXBCL2/adenovirus E1B 19kD-interacting protein 3-like

Background

Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, Hrk, Nip3, and Bim, form a growingsubclass of the Bcl-2 family. A novel BH3 domaincontaining protein was recently identified and designated Bnip3L, Bnip3a, and Nix (for Nip3-like protein X) (Matsushima, M. et al.; Yasuda, M. et al.; Chen, G, et al.).Bnip3L/Bnip3a/Nix is a homolog of the E1B 19K/Bcl-2 binding and pro-apoptotic protein Bnip3. Over expression of Bnip3L induces apoptosis (Yasuda, M. et al.; Chen, G, et al.). Bnip3L interacts withand overcomes suppresses by Bcl-2 and Bcl-xL. Bnip3Lis localized in mitochondria. The messenger RNA of Bnip3L is ubiquitously expressed in human tissues (Matsushima, M. et al.; Yasuda, M. et al.). Bnip3L and Bnip3 form a new subfamily of the pro-apoptotic mitochondrial proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: BNIP3L