BNIP1 Antibody


Immunohistochemistry-Paraffin: BNIP1 Antibody [NBP1-82567] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: BNIP1 Antibody [NBP1-82567] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: BNIP1 Antibody [NBP1-82567] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: BNIP1 Antibody [NBP1-82567] - Staining in human testis and skeletal muscle tissues using anti-BNIP1 antibody. Corresponding BNIP1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

BNIP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: APQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQE
Specificity of human BNIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BNIP1 Protein (NBP1-82567PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BNIP1 Antibody

  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 1
  • BCL2/adenovirus E1B 19kDa interacting protein 1
  • BCL2/adenovirus E1B 19kD-interacting protein 1
  • Nip1
  • SEC20
  • SEC20L
  • Transformation-related gene 8 protein
  • TRG-8
  • vesicle transport protein SEC20


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Ch, Xp, Mu(-)
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IP

Publications for BNIP1 Antibody (NBP1-82567) (0)

There are no publications for BNIP1 Antibody (NBP1-82567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNIP1 Antibody (NBP1-82567) (0)

There are no reviews for BNIP1 Antibody (NBP1-82567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BNIP1 Antibody (NBP1-82567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BNIP1 Products

Bioinformatics Tool for BNIP1 Antibody (NBP1-82567)

Discover related pathways, diseases and genes to BNIP1 Antibody (NBP1-82567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNIP1 Antibody (NBP1-82567)

Discover more about diseases related to BNIP1 Antibody (NBP1-82567).

Pathways for BNIP1 Antibody (NBP1-82567)

View related products by pathway.

PTMs for BNIP1 Antibody (NBP1-82567)

Learn more about PTMs related to BNIP1 Antibody (NBP1-82567).

Research Areas for BNIP1 Antibody (NBP1-82567)

Find related products by research area.

Blogs on BNIP1

There are no specific blogs for BNIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BNIP1 Antibody and receive a gift card or discount.


Gene Symbol BNIP1