BNIP1 Antibody

Images

 
Western Blot: BNIP1 Antibody [NBP1-69182] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BNIP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to BNIP1 (BCL2/adenovirus E1B 19kDa interacting protein 1) The peptide sequence was selected from the N terminal of BNIP1. Peptide sequence DFNSPTTPVTFSDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BNIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BNIP1 and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BNIP1 Antibody

  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 1
  • BCL2/adenovirus E1B 19kDa interacting protein 1
  • BCL2/adenovirus E1B 19kD-interacting protein 1
  • Nip1
  • SEC20
  • SEC20L
  • Transformation-related gene 8 protein
  • TRG-8
  • vesicle transport protein SEC20

Background

This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56150
Species: Hu, Rt, Po, Ch, Xp, Mu(-)
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-82785
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP1-85911
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-78264
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88559
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NB100-511
Species: Hu, Mu, Rt
Applications: WB, IP

Publications for BNIP1 Antibody (NBP1-69182) (0)

There are no publications for BNIP1 Antibody (NBP1-69182).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNIP1 Antibody (NBP1-69182) (0)

There are no reviews for BNIP1 Antibody (NBP1-69182). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BNIP1 Antibody (NBP1-69182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BNIP1 Products

Bioinformatics Tool for BNIP1 Antibody (NBP1-69182)

Discover related pathways, diseases and genes to BNIP1 Antibody (NBP1-69182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNIP1 Antibody (NBP1-69182)

Discover more about diseases related to BNIP1 Antibody (NBP1-69182).
 

Pathways for BNIP1 Antibody (NBP1-69182)

View related products by pathway.

PTMs for BNIP1 Antibody (NBP1-69182)

Learn more about PTMs related to BNIP1 Antibody (NBP1-69182).
 

Research Areas for BNIP1 Antibody (NBP1-69182)

Find related products by research area.

Blogs on BNIP1

There are no specific blogs for BNIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BNIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BNIP1
Uniprot