BMPR-IB/ALK-6 Antibody (2E2.)

Images

 
Western Blot: BMPR-IB/ALK-6 Antibody (2E2) [H00000658-M07] - Analysis of BMPR1B expression in HeLa (Cat # L013V1).
Western Blot: BMPR-IB/ALK-6 Antibody (2E2) [H00000658-M07] - Analysis of BMPR1B expression in NIH/3T3 (Cat # L018V1).
ELISA: BMPR-IB/ALK-6 Antibody (2E2) [H00000658-M07] - Detection limit for recombinant GST tagged BMPR1B is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
2E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BMPR-IB/ALK-6 Antibody (2E2.) Summary

Immunogen
BMPR1B (AAH47773.1, 24 a.a. - 127 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRA
Specificity
BMPR1B - bone morphogenetic protein receptor, type IB (2E2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BMPR1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BMPR-IB/ALK-6 Antibody (2E2.)

  • activin receptor-like kinase 6
  • ALK-6
  • ALK6CDw293
  • BMP type-1B receptor
  • BMPR1B
  • BMPR-1B
  • BMPRIB
  • BMPR-IB
  • bone morphogenetic protein receptor type-1B
  • bone morphogenetic protein receptor, type IB
  • CDw293 antigen
  • CDw293
  • EC 2.7.11
  • EC 2.7.11.30
  • serine/threonine receptor kinase

Background

This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs, which are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in this gene have been associated with primary pulmonary hypertension. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF346
Species: Hu
Applications: WB, Flow, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
AF853
Species: Mu
Applications: WB, IHC
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
AF4210
Species: Hu
Applications: WB, IHC
AF2097
Species: Hu
Applications: WB, ChIP, ICC

Publications for BMPR-IB/ALK-6 Antibody (H00000658-M07) (0)

There are no publications for BMPR-IB/ALK-6 Antibody (H00000658-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMPR-IB/ALK-6 Antibody (H00000658-M07) (0)

There are no reviews for BMPR-IB/ALK-6 Antibody (H00000658-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMPR-IB/ALK-6 Antibody (H00000658-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMPR-IB/ALK-6 Products

Bioinformatics Tool for BMPR-IB/ALK-6 Antibody (H00000658-M07)

Discover related pathways, diseases and genes to BMPR-IB/ALK-6 Antibody (H00000658-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMPR-IB/ALK-6 Antibody (H00000658-M07)

Discover more about diseases related to BMPR-IB/ALK-6 Antibody (H00000658-M07).
 

Pathways for BMPR-IB/ALK-6 Antibody (H00000658-M07)

View related products by pathway.

PTMs for BMPR-IB/ALK-6 Antibody (H00000658-M07)

Learn more about PTMs related to BMPR-IB/ALK-6 Antibody (H00000658-M07).
 

Research Areas for BMPR-IB/ALK-6 Antibody (H00000658-M07)

Find related products by research area.

Blogs on BMPR-IB/ALK-6

There are no specific blogs for BMPR-IB/ALK-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMPR-IB/ALK-6 Antibody (2E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol BMPR1B
Entrez
Uniprot