BMP-8b Antibody - BSA Free

Western Blot: BMP-8b Antibody [NBP3-10678] - Western blot analysis of BMP-8b in NCI-H226 Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BMP-8b Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BMP-8b Antibody - BSA Free (NBP3-10678) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human BMP-8b (NP_001711.2). Peptide sequence CPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BMP8B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BMP-8b Antibody - BSA Free

• BMP-8
• BMP-8b
• bone morphogenetic protein 8b
• MGC131757
• OP-3

Background

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bonegrowth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identifiedby an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site.Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development.In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible boneinductive activity. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BMP8B