BMI-1 Antibody

Images

 
Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human kidney shows strong nuclear positivity in cells in tubules.
Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BMI-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BMI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
This antibody is useful for Immunohistochemistry-Paraffin, Western Blot. For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
BMI-1 Recombinant Protein Antigen (NBP1-87321PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BMI-1 Antibody

  • B lymphoma Mo-MLV insertion region 1 homolog (mouse)
  • B lymphoma Mo-MLV insertion region 1 homolog
  • BMI1 polycomb ring finger oncogene
  • BMI1
  • BMI-1
  • FLVI2/BMI1
  • MGC12685
  • murine leukemia viral (bmi-1) oncogene homolog
  • PCGF4
  • polycomb complex protein BMI-1
  • polycomb group protein Bmi1
  • polycomb group ring finger 4
  • RING finger protein 51
  • RNF51
  • RNF51Polycomb group RING finger protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-83976
Species: Hu, Mu, Pm
Applications: WB
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for BMI-1 Antibody (NBP1-87321) (0)

There are no publications for BMI-1 Antibody (NBP1-87321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMI-1 Antibody (NBP1-87321) (0)

There are no reviews for BMI-1 Antibody (NBP1-87321). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMI-1 Antibody (NBP1-87321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMI-1 Antibody Products

Related Products by Gene

Bioinformatics Tool for BMI-1 Antibody (NBP1-87321)

Discover related pathways, diseases and genes to BMI-1 Antibody (NBP1-87321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMI-1 Antibody (NBP1-87321)

Discover more about diseases related to BMI-1 Antibody (NBP1-87321).
 

Pathways for BMI-1 Antibody (NBP1-87321)

View related products by pathway.

PTMs for BMI-1 Antibody (NBP1-87321)

Learn more about PTMs related to BMI-1 Antibody (NBP1-87321).
 

Research Areas for BMI-1 Antibody (NBP1-87321)

Find related products by research area.

Blogs on BMI-1

There are no specific blogs for BMI-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMI-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BMI1
Entrez
Uniprot

Customers Who Bought This Also Bought