BMI-1 Antibody

Images

 
Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human kidney shows strong nuclear positivity in cells in tubules.
Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

BMI-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BMI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
This antibody is useful for Immunohistochemistry-Paraffin, Western Blot. For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
BMI-1 Recombinant Protein Antigen (NBP1-87321PEP)

Alternate Names for BMI-1 Antibody

  • B lymphoma Mo-MLV insertion region 1 homolog (mouse)
  • B lymphoma Mo-MLV insertion region 1 homolog
  • BMI1 polycomb ring finger oncogene
  • BMI1
  • BMI-1
  • FLVI2/BMI1
  • MGC12685
  • murine leukemia viral (bmi-1) oncogene homolog
  • PCGF4
  • polycomb complex protein BMI-1
  • polycomb group protein Bmi1
  • polycomb group ring finger 4
  • RING finger protein 51
  • RNF51
  • RNF51Polycomb group RING finger protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-96140
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB110-83976
Species: Hu, Mu, Pm
Applications: WB
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
MAB1489
Species: Hu
Applications: WB
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for BMI-1 Antibody (NBP1-87321) (0)

There are no publications for BMI-1 Antibody (NBP1-87321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMI-1 Antibody (NBP1-87321) (0)

There are no reviews for BMI-1 Antibody (NBP1-87321). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMI-1 Antibody (NBP1-87321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMI-1 Antibody Products

Related Products by Gene

Bioinformatics Tool for BMI-1 Antibody (NBP1-87321)

Discover related pathways, diseases and genes to BMI-1 Antibody (NBP1-87321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMI-1 Antibody (NBP1-87321)

Discover more about diseases related to BMI-1 Antibody (NBP1-87321).
 

Pathways for BMI-1 Antibody (NBP1-87321)

View related products by pathway.

PTMs for BMI-1 Antibody (NBP1-87321)

Learn more about PTMs related to BMI-1 Antibody (NBP1-87321).
 

Research Areas for BMI-1 Antibody (NBP1-87321)

Find related products by research area.

Blogs on BMI-1

There are no specific blogs for BMI-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our BMI-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BMI1
Entrez
Uniprot

Customers Who Bought This Also Bought