BIN3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit BIN3 Antibody - BSA Free (NBP1-85988) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNPLCEQDQD |
| Predicted Species |
Mouse (95%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BIN3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for BIN3 Antibody - BSA Free
Background
BIN3, also known as Bridging integrator 3, is a 253 amino acid protein that plays a role in cell membrane shape and structure through interaction with GTPases, and members of the BAR domain protein family have been shown to be involved in processes such as intracellular transport and endocytosis. This protein is currently being studied for research on the following diseases and disorders, ornithosis, pancreatic cancer, and pancreatitis. Interactions with the BIN3 protein have been shown to involve DNMBP, GRPEL1, VDAC3, POR, and RAD23B, CAP2B, and ERH in cell cycle, actin filament organization, cytokinesis, protein localization, and barrier septum assembly pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for BIN3 Antibody (NBP1-85988) (0)
There are no publications for BIN3 Antibody (NBP1-85988).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BIN3 Antibody (NBP1-85988) (0)
There are no reviews for BIN3 Antibody (NBP1-85988).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for BIN3 Antibody (NBP1-85988) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional BIN3 Products
Blogs on BIN3