BIN3 Antibody - BSA Free

Immunohistochemistry-Paraffin: BIN3 Antibody [NBP1-85988] - Staining of human urinary bladder shows strong granular cytoplasmic positivity in urothelial cells.

Analysis in control (vector only transfected HEK293T lysate) and BIN3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BIN3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BIN3 Antibody - BSA Free (NBP1-85988) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNPLCEQDQD
• Predicted Species: Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BIN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BIN3 Protein (NBP1-85988PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BIN3 Antibody - BSA Free

• bridging integrator 3
• MGC14978

Background

BIN3, also known as Bridging integrator 3, is a 253 amino acid protein that plays a role in cell membrane shape and structure through interaction with GTPases, and members of the BAR domain protein family have been shown to be involved in processes such as intracellular transport and endocytosis. This protein is currently being studied for research on the following diseases and disorders, ornithosis, pancreatic cancer, and pancreatitis. Interactions with the BIN3 protein have been shown to involve DNMBP, GRPEL1, VDAC3, POR, and RAD23B, CAP2B, and ERH in cell cycle, actin filament organization, cytokinesis, protein localization, and barrier septum assembly pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BIN3