BIN2 Antibody

Images

 
Western Blot: BIN2 Antibody [NBP2-48690] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining in human bone marrow and pancreas tissues using anti-BIN2 antibody. Corresponding BIN2 RNA-seq data are presented for the same tissues.
Immunohistochemistry: BIN2 Antibody [NBP2-48690] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BIN2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EKPVRTPEAKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISADSSEGQDQLQVSMVPENNNLTAPEPQEEVSTSENPQL
Specificity
Specificity of human BIN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BIN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BIN2 Recombinant Protein Antigen (NBP2-48690PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BIN2 Antibody

  • BRAP1
  • BRAP-1
  • breast cancer associated protein BRAP1
  • Breast cancer-associated protein 1
  • bridging integrator 2
  • bridging integrator-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NLS2656
Species: Hu
Applications: WB, IHC, IHC-P, ICC
PP-A9033A-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46170
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-03389
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13798
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for BIN2 Antibody (NBP2-48690) (0)

There are no publications for BIN2 Antibody (NBP2-48690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BIN2 Antibody (NBP2-48690) (0)

There are no reviews for BIN2 Antibody (NBP2-48690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BIN2 Antibody (NBP2-48690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BIN2 Antibody (NBP2-48690)

Discover related pathways, diseases and genes to BIN2 Antibody (NBP2-48690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BIN2 Antibody (NBP2-48690)

Discover more about diseases related to BIN2 Antibody (NBP2-48690).
 

Pathways for BIN2 Antibody (NBP2-48690)

View related products by pathway.

PTMs for BIN2 Antibody (NBP2-48690)

Learn more about PTMs related to BIN2 Antibody (NBP2-48690).

Blogs on BIN2

There are no specific blogs for BIN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BIN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BIN2