beta-Synuclein Recombinant Protein Antigen

Images

 
There are currently no images for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

beta-Synuclein Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SNCB.

Source: E.coli

Amino Acid Sequence: GNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SNCB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90342.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for beta-Synuclein Recombinant Protein Antigen

  • beta-Synuclein
  • SNCB
  • synuclein, beta
  • Synuclein-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-55955
Species: Hu
Applications: ICC/IF, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-90342PEP
Species: Hu
Applications: AC

Publications for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP) (0)

There are no publications for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP) (0)

There are no reviews for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional beta-Synuclein Products

Bioinformatics Tool for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP)

Discover related pathways, diseases and genes to beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP)

Discover more about diseases related to beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP).
 

Pathways for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP)

View related products by pathway.

PTMs for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP)

Learn more about PTMs related to beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP).
 

Research Areas for beta-Synuclein Recombinant Protein Antigen (NBP1-90342PEP)

Find related products by research area.

Blogs on beta-Synuclein

There are no specific blogs for beta-Synuclein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our beta-Synuclein Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SNCB
Entrez