Beta-endorphin Antibody

Images

 
Immunohistochemistry: Beta-endorphin Antibody [NB120-10339] - Detection of beta-Endorphin (dark-blue varicosities and processes) in rat pituitary (HRP-DAB-with Ni enhancement).

Product Details

Summary
Reactivity RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
LYOPH

Order Details

Beta-endorphin Antibody Summary

Immunogen
Antiserum to beta Endorphin was raised in rabbits by using the N-terminal portion of bovine beta Endorphin conjugated to thyroglobulin. (YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE)
Localization
Secreted
Specificity
Cross reactivity: beta-endorphin (100%), Met-enkephalin (0.03%), Leu-enkephalin (0.02%), beta-lipotropin (0.34%).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POMC
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 15 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Application Notes
For slide-mounted tissue sections it is recommended to make working dilution for immunofluorescence histochemistry 15 ug/ml, whereas for avidin-biotin immunohistochemistry antiserum may be diluted to 5 ug/ml. Optimal dilutions/concentrations should be determined by the end user.
Positive Control
POMC Lysate (NBL1-14599)

Reactivity Notes

Rat. Not yet tested in other species.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
Whole antisera
Preservative
0.1% Sodium Azide
Concentration
LYOPH
Purity
Unpurified
Reconstitution Instructions
Reconstitute with deionized water.

Alternate Names for Beta-endorphin Antibody

  • ACTH
  • adrenocorticotropic hormone
  • adrenocorticotropin
  • alpha-melanocyte-stimulating hormone
  • alpha-MSH
  • beta-endorphin
  • beta-LPH
  • beta-melanocyte-stimulating hormone
  • beta-MSH
  • CLIP
  • corticotropin-like intermediary peptide
  • corticotropin-lipotropin
  • gamma-LPH
  • gamma-MSH
  • lipotropin beta
  • lipotropin gamma
  • LPH
  • melanotropin alpha
  • melanotropin beta
  • melanotropin gamma
  • met-enkephalin
  • MSH
  • NPP
  • POC
  • pro-ACTH-endorphin
  • proopiomelanocortin preproprotein
  • proopiomelanocortin
  • pro-opiomelanocortin

Background

ACTH occurs in cells of the anterior pituitary and in neurons in brain. It regulates the corticosteroid production in the adrenal cortex. Beta endorphin and Met enkephalin are endogenous opiates. MSH (melanocyte stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
7570-GH
Species: Hu
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
9134-TN
Species: Hu
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for Beta-endorphin Antibody (NB120-10339) (0)

There are no publications for Beta-endorphin Antibody (NB120-10339).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Beta-endorphin Antibody (NB120-10339) (0)

There are no reviews for Beta-endorphin Antibody (NB120-10339). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Beta-endorphin Antibody (NB120-10339). (Showing 1 - 3 of 3 FAQ).

  1. Our lab recently ordered the antibody Beta-endorphin (NB120-10339). From the datasheet it is not obvious how to aliquot the antibody, since the serum concentration is not clear. Can you give us some additional advice?
    • We suggest to make 10 uL aliquotes (in screw cap vials only!) and freeze them at -20C or -80C. Keep vials in a tight air-sealed container to prevent evaporation during the storage.
  2. How much lyophilized serum is in the tube and with how much diH2O should I reconstitute the serum?
    • In this tube there should be 50 ug: dilute it with 50 uL of PBS to make 1 mg/mL.
  3. The customer would like to know the recommended IHC-P protocol and antigen retrieval method.
    • Please see the general protocol that is used for IHC in our lab. The antigen retrieval can be performed following next steps: (1) Prepare Citrate Buffer (10mM Citric Acid, 0.05% Tween 20, pH 6.0) by dissolve citric acid (anhydrous) 1.92 g in distilled water to a total of 1000 ml and adjusting the pH to 6.0 w/ 1N NaOH followed by addition of 0.5 ml of Tween 20 to the same). (2) Pre-heat steamer or water bath with staining dish containing Sodium Citrate Buffer or Citrate Buffer until temperature reaches 95-100 degrees Celsius. Immerse slides in the staining dish. Place the lid loosely on the staining dish and incubate for 20-40 minutes. (3) Remove the staining dish to room temperature and allow the slides to cool for 20 minutes before proceeding with normal staining procedure.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Beta-endorphin Products

Beta-endorphin NB120-10339

Bioinformatics Tool for Beta-endorphin Antibody (NB120-10339)

Discover related pathways, diseases and genes to Beta-endorphin Antibody (NB120-10339). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Beta-endorphin Antibody (NB120-10339)

Discover more about diseases related to Beta-endorphin Antibody (NB120-10339).
 

Pathways for Beta-endorphin Antibody (NB120-10339)

View related products by pathway.

PTMs for Beta-endorphin Antibody (NB120-10339)

Learn more about PTMs related to Beta-endorphin Antibody (NB120-10339).
 

Research Areas for Beta-endorphin Antibody (NB120-10339)

Find related products by research area.

Blogs on Beta-endorphin

There are no specific blogs for Beta-endorphin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Beta-endorphin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POMC
Entrez
Uniprot