Beta-endorphin Antibody


Immunohistochemistry: Beta-endorphin Antibody [NB120-10339] - Detection of beta-Endorphin (dark-blue varicosities and processes) in rat pituitary (HRP-DAB-with Ni enhancement).

Product Details

Reactivity RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
This product is unpurified. The exact concentration of antibody is not quantifiable.

Order Details

Beta-endorphin Antibody Summary

Antiserum to beta Endorphin was raised in rabbits by using the N-terminal portion of bovine beta Endorphin conjugated to thyroglobulin. (YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE)
Cross reactivity: beta-endorphin (100%), Met-enkephalin (0.03%), Leu-enkephalin (0.02%), beta-lipotropin (0.34%).
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Whole antisera
0.1% Sodium Azide
This product is unpurified. The exact concentration of antibody is not quantifiable.
Reconstitution Instructions
Reconstitute with deionized water.


  • Immunocytochemistry/Immunofluorescence 15 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Application Notes
For slide-mounted tissue sections it is recommended to make working dilution for immunofluorescence histochemistry 15 ug/ml, whereas for avidin-biotin immunohistochemistry antiserum may be diluted to 5 ug/ml. Optimal dilutions/concentrations should be determined by the end user.

Reactivity Notes

Rat. Not yet tested in other species.

Alternate Names for Beta-endorphin Antibody

  • ACTH
  • adrenocorticotropic hormone
  • adrenocorticotropin
  • alpha-melanocyte-stimulating hormone
  • alpha-MSH
  • beta-endorphin
  • beta-LPH
  • beta-melanocyte-stimulating hormone
  • beta-MSH
  • CLIP
  • corticotropin-like intermediary peptide
  • corticotropin-lipotropin
  • gamma-LPH
  • gamma-MSH
  • lipotropin beta
  • lipotropin gamma
  • LPH
  • melanotropin alpha
  • melanotropin beta
  • melanotropin gamma
  • met-enkephalin
  • MSH
  • NPP
  • POC
  • pro-ACTH-endorphin
  • proopiomelanocortin preproprotein
  • proopiomelanocortin
  • pro-opiomelanocortin


ACTH occurs in cells of the anterior pituitary and in neurons in brain. It regulates the corticosteroid production in the adrenal cortex. Beta endorphin and Met enkephalin are endogenous opiates. MSH (melanocyte stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow
Species: Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Beta-endorphin Antibody (NB120-10339) (0)

There are no publications for Beta-endorphin Antibody (NB120-10339).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Beta-endorphin Antibody (NB120-10339) (0)

There are no reviews for Beta-endorphin Antibody (NB120-10339). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Beta-endorphin Antibody (NB120-10339). (Showing 1 - 3 of 3 FAQ).

  1. Our lab recently ordered the antibody Beta-endorphin (NB120-10339). From the datasheet it is not obvious how to aliquot the antibody, since the serum concentration is not clear. Can you give us some additional advice?
    • We suggest to make 10 uL aliquotes (in screw cap vials only!) and freeze them at -20C or -80C. Keep vials in a tight air-sealed container to prevent evaporation during the storage.
  2. How much lyophilized serum is in the tube and with how much diH2O should I reconstitute the serum?
    • In this tube there should be 50 ug: dilute it with 50 uL of PBS to make 1 mg/mL.
  3. The customer would like to know the recommended IHC-P protocol and antigen retrieval method.
    • Please see the general protocol that is used for IHC in our lab. The antigen retrieval can be performed following next steps: (1) Prepare Citrate Buffer (10mM Citric Acid, 0.05% Tween 20, pH 6.0) by dissolve citric acid (anhydrous) 1.92 g in distilled water to a total of 1000 ml and adjusting the pH to 6.0 w/ 1N NaOH followed by addition of 0.5 ml of Tween 20 to the same). (2) Pre-heat steamer or water bath with staining dish containing Sodium Citrate Buffer or Citrate Buffer until temperature reaches 95-100 degrees Celsius. Immerse slides in the staining dish. Place the lid loosely on the staining dish and incubate for 20-40 minutes. (3) Remove the staining dish to room temperature and allow the slides to cool for 20 minutes before proceeding with normal staining procedure.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Beta-endorphin Antibody Products

Beta-endorphin NB120-10339

Related Products by Gene

Bioinformatics Tool for Beta-endorphin Antibody (NB120-10339)

Discover related pathways, diseases and genes to Beta-endorphin Antibody (NB120-10339). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Beta-endorphin Antibody (NB120-10339)

Discover more about diseases related to Beta-endorphin Antibody (NB120-10339).

Pathways for Beta-endorphin Antibody (NB120-10339)

View related products by pathway.

PTMs for Beta-endorphin Antibody (NB120-10339)

Learn more about PTMs related to Beta-endorphin Antibody (NB120-10339).

Research Areas for Beta-endorphin Antibody (NB120-10339)

Find related products by research area.

Blogs on Beta-endorphin

There are no specific blogs for Beta-endorphin, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol POMC

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NB120-10339 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought