Beta-endorphin Antibody

Immunohistochemistry: Beta-endorphin Antibody [NB120-10339] - Detection of beta-Endorphin in rat ventral lateral periaqueductal grey matter (PAG). Brain was fixed with 4% formaldehyde and cut into 10 um thick cryostat sections. Tissue was incubated with rabbit polyclonal antibody to beta-Endorphin at 10 ug/mL overnight at 4 degrees C followed by incubation with Donkey anti-rabbit Rhodamine Red conjugated secondary antibodies at 1:200. Tissue was counterstained with DAPI (blue color) to visualize cell nuclei.

Product Discontinued

Beta-endorphin Antibody Summary

• Immunogen: Antiserum to beta Endorphin was raised in rabbits by using the N-terminal portion of bovine beta Endorphin conjugated to thyroglobulin. (YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE)
• Localization: Secreted
• Specificity: Cross reactivity: beta-endorphin (100%), Met-enkephalin (0.03%), Leu-enkephalin (0.02%), beta-lipotropin (0.34%).
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POMC
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 5-15 ug/ml
  • Immunohistochemistry 5-10 ug/ml
  • Immunohistochemistry-Paraffin 5-10 ug/ml
• Application Notes: For slide-mounted tissue sections it is recommended to make working dilution for immunofluorescence histochemistry 15 ug/ml, whereas for avidin-biotin immunohistochemistry antiserum may be diluted to 5 ug/ml. Optimal dilutions/concentrations should be determined by the end user.
• Control:

  POMC Overexpression Lysate

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 10 mM PBS
• Preservative: 0.1% Sodium Azide
• Concentration: LYOPH
• Purity: Unpurified
• Reconstitution Instructions: Reconstitute with deionized water.

Alternate Names for Beta-endorphin Antibody

• ACTH
• adrenocorticotropic hormone
• adrenocorticotropin
• alpha-melanocyte-stimulating hormone
• alpha-MSH
• beta-endorphin
• beta-LPH
• beta-melanocyte-stimulating hormone
• beta-MSH
• CLIP
• corticotropin-like intermediary peptide
• corticotropin-lipotropin
• gamma-LPH
• gamma-MSH
• lipotropin beta
• lipotropin gamma
• LPH
• melanotropin alpha
• melanotropin beta
• melanotropin gamma
• met-enkephalin
• MSH
• NPP
• POC
• pro-ACTH-endorphin
• proopiomelanocortin preproprotein
• proopiomelanocortin
• pro-opiomelanocortin

Background

ACTH occurs in cells of the anterior pituitary and in neurons in brain. It regulates the corticosteroid production in the adrenal cortex. Beta endorphin and Met enkephalin are endogenous opiates. MSH (melanocyte stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Beta-endorphin Antibody (NB120-10339). (Showing 1 - 3 of 3 FAQ).

1. Our lab recently ordered the antibody Beta-endorphin (NB120-10339). From the datasheet it is not obvious how to aliquot the antibody, since the serum concentration is not clear. Can you give us some additional advice?
   • We suggest to make 10 uL aliquotes (in screw cap vials only!) and freeze them at -20C or -80C. Keep vials in a tight air-sealed container to prevent evaporation during the storage.
2. How much lyophilized serum is in the tube and with how much diH2O should I reconstitute the serum?
   • In this tube there should be 50 ug: dilute it with 50 uL of PBS to make 1 mg/mL.
3. The customer would like to know the recommended IHC-P protocol and antigen retrieval method.
   • Please see the general protocol that is used for IHC in our lab. The antigen retrieval can be performed following next steps: (1) Prepare Citrate Buffer (10mM Citric Acid, 0.05% Tween 20, pH 6.0) by dissolve citric acid (anhydrous) 1.92 g in distilled water to a total of 1000 ml and adjusting the pH to 6.0 w/ 1N NaOH followed by addition of 0.5 ml of Tween 20 to the same). (2) Pre-heat steamer or water bath with staining dish containing Sodium Citrate Buffer or Citrate Buffer until temperature reaches 95-100 degrees Celsius. Immerse slides in the staining dish. Place the lid loosely on the staining dish and incubate for 20-40 minutes. (3) Remove the staining dish to room temperature and allow the slides to cool for 20 minutes before proceeding with normal staining procedure.

Bioinformatics

• Gene Symbol: POMC
• Entrez:
  • 24664(Rat)
• Uniprot:
  • P01194(Rat)