Bcl3 Antibody - BSA Free

Western Blot: Bcl3 Antibody [NBP2-87069] - Host: Rabbit. Target Name: BCL3. Sample Tissue: Human A549 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Bcl3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human Bcl3. Peptide sequence: SPSQSPPRDPPGFPMAPPNFFLPSPSPPAFLPFAGVLRGPGRPVPPSPAP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Bcl3 Antibody - BSA Free

• B-cell CLL/lymphoma 3
• B-cell leukemia/lymphoma 3
• B-cell lymphoma 3 protein
• B-cell lymphoma 3-encoded protein
• BCL-3
• BCL4
• chronic lymphatic leukemia protein
• D19S37
• Proto-oncogene BCL3

Background

The transcriptional coactivator, B-cell lymphoma 3-encoded protein (Bcl3) is a member of the inhibitor of nuclear factor kappaB (NF-kappaB) family. Also a known regulator of NF-kappaB, Bcl-3 plays a critical role in the development of normal immune responses. Specifically, Bcl 3 regulates transcriptional activation of NF-kappa-B target genes, by inhibiting the nuclear translocation of the NF-kappa-B p50 subunit in the cytoplasm and acting as transcriptional activator that promotes transcription of NF-kappa-B target genes in the nucleus.

Bcl-3 also contributes to the regulation of cell proliferation, and influences the survival of T cells when they are activated as a result of an immune response. It also contributes to chronic inflammatory disease states such as osteoarthritis and rheumatoid arthritis, and defects in Bcl3 may lead to B-cell chronic lymphocytic leukemia. Therefore, Bcl3 antibodies can be useful tools for studying autoimmune disease and cancer development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL3