Bcl3 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Bcl3. Peptide sequence: MVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLS The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
BCL3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Bcl3 Antibody - BSA Free
Background
The transcriptional coactivator, B-cell lymphoma 3-encoded protein (Bcl3) is a member of the inhibitor of nuclear factor kappaB (NF-kappaB) family. Also a known regulator of NF-kappaB, Bcl-3 plays a critical role in the development of normal immune responses. Specifically, Bcl 3 regulates transcriptional activation of NF-kappa-B target genes, by inhibiting the nuclear translocation of the NF-kappa-B p50 subunit in the cytoplasm and acting as transcriptional activator that promotes transcription of NF-kappa-B target genes in the nucleus.
Bcl-3 also contributes to the regulation of cell proliferation, and influences the survival of T cells when they are activated as a result of an immune response. It also contributes to chronic inflammatory disease states such as osteoarthritis and rheumatoid arthritis, and defects in Bcl3 may lead to B-cell chronic lymphocytic leukemia. Therefore, Bcl3 antibodies can be useful tools for studying autoimmune disease and cancer development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Mu
Applications: Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Publications for Bcl3 Antibody (NBP2-87068) (0)
There are no publications for Bcl3 Antibody (NBP2-87068).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Bcl3 Antibody (NBP2-87068) (0)
There are no reviews for Bcl3 Antibody (NBP2-87068).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Bcl3 Antibody (NBP2-87068) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Bcl3 Products
Research Areas for Bcl3 Antibody (NBP2-87068)
Find related products by research area.
|
Blogs on Bcl3