BCL2L12 Antibody (4Z2Z8)

Western Blot: BCL2L12 Antibody (4Z2Z8) [NBP3-15930] - Western blot analysis of extracts of various cell lines, using BCL2L12 Rabbit mAb (NBP3-15930) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: BCL2L12 Antibody (4Z2Z8) [NBP3-15930] - Immunohistochemistry of paraffin-embedded human esophageal cancer using BCL2L12 Rabbit mAb (NBP3-15930) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunoprecipitation: BCL2L12 Antibody (4Z2Z8) [BCL2L12] - Immunoprecipitation analysis of 300 ug extracts of PC-3 cells using 3 ug BCL2L12 antibody . Western blot was performed from the immunoprecipitate using BCL2L12 antibody at a dilution of 1:500.

• Reactivity: Hu
• Applications: WB, IHC, IP
• Clone: 4Z2Z8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

BCL2L12 Antibody (4Z2Z8) Summary

• Description: Novus Biologicals Rabbit BCL2L12 Antibody (4Z2Z8) (NBP3-15930) is a recombinant monoclonal antibody validated for use in IHC, WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09). GPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: BCL2L12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:100 - 1:500
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BCL2L12 Antibody (4Z2Z8)

• Bcl-2 related proline-rich protein
• bcl2-L-12
• BCL2-like 12 (proline rich)
• bcl-2-like protein 12
• Bcl-2-related proline-rich protein
• BPR
• MGC120313
• MGC120314
• MGC120315

Background

BCL2L12 belongs to the BCL-2 protein family which is involved in several cellular activities. This protein is known to have interaction with BCL2L1, HSPA1A, and HSPA1B. Expression of BCL2L12 results in the resistance to apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL2L12