Bcl G Antibody

Images

 
Western Blot: Bcl G Antibody [NBP1-91697] - Analysis in control (vector only transfected HEK293T lysate) and BCL2L14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: Bcl G Antibody [NBP1-91697] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Bcl G Antibody [NBP1-91697] - Staining in human rectum and pancreas tissues using anti-BCL2L14 antibody. Corresponding BCL2L14 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: Bcl G Antibody [NBP1-91697] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Bcl G Antibody [NBP1-91697] - Staining of human rectum shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Bcl G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL
Specificity
Specificity of human Bcl G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCL2L14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Bcl G Antibody

  • apoptosis facilitator Bcl-2-like protein 14
  • Apoptosis regulator Bcl-G
  • Bcl2-L-14
  • BCL2-like 14 (apoptosis facilitator)
  • BCL-G
  • BCLGbcl2-L-14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55090
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
AF4820
Species: Hu
Applications: WB, IHC
NBP2-24501
Species: Hu, Mu, Bv, Pm
Applications: WB, IHC-P
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
AF860
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46578
Species: Hu, Mu
Applications: WB, IHC
NBP1-85884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Bcl G Antibody (NBP1-91697) (0)

There are no publications for Bcl G Antibody (NBP1-91697).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bcl G Antibody (NBP1-91697) (0)

There are no reviews for Bcl G Antibody (NBP1-91697). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Bcl G Antibody (NBP1-91697) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Bcl G Products

Bioinformatics Tool for Bcl G Antibody (NBP1-91697)

Discover related pathways, diseases and genes to Bcl G Antibody (NBP1-91697). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bcl G Antibody (NBP1-91697)

Discover more about diseases related to Bcl G Antibody (NBP1-91697).
 

Pathways for Bcl G Antibody (NBP1-91697)

View related products by pathway.

PTMs for Bcl G Antibody (NBP1-91697)

Learn more about PTMs related to Bcl G Antibody (NBP1-91697).
 

Research Areas for Bcl G Antibody (NBP1-91697)

Find related products by research area.

Blogs on Bcl G

There are no specific blogs for Bcl G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bcl G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL2L14