Recombinant Human BCAP31 GST (N-Term) Protein

SDS-Page: Recombinant Human BCAP31 Protein [H00010134-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human BCAP31 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-246 of Human BCAP31
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: BCAP31
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 54.4 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BCAP31 GST (N-Term) Protein

• 6C6-Ag
• BAP31
• Bap31,6C6-AG
• BAP31DXS1357ECDM
• BCAP31
• B-cell receptor-associated protein 31
• BCR-associated protein 31
• BCR-associated protein Bap31,6C6-AG tumor-associated antigen
• p28 Bap31,6C6-Ag
• p28
• Protein CDM

Background

BAP31 (B Cell Receptor Associated Protein, 28 kDa) is a multiple membrane spanning protein of the endoplasmic reticulum. It has been shown to form both homo and hetero oligomers with the closely related BAP29, and is a potential apoptotic regulator as a predicted BCL2/BCLXL associated protein. In the C terminal domain of BAP31, there are two identical recognition sites for initiator Caspases 1 and 8 of the programmed death cascade. It is hypothesized that BAP31 plays a role in the transport of selected proteins to the Golgi apparatus. BAP31 has also been shown to control expression of CFTR (cystic fibrosis transmembrane conductance regulator). It is believed that interference with the expression or function of BAP31 in epithelial cells may be a way to circumvent the chloride channel defect in cystic fibrosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: BCAP31