BBS7 Antibody

Images

 
Western Blot: BBS7 Antibody [NBP1-88690] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: BBS7 Antibody [NBP1-88690] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, ICC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BBS7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BBS7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Immunocytochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BBS7 Protein (NBP1-88690PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BBS7 Antibody

  • Bardet-Biedl syndrome 7
  • BBS2L1Bardet-Biedl syndrome 7 protein
  • BBS2-like 1
  • BBS2-like protein 1
  • FLJ10715

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34106
Species: Hu
Applications: IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88688
Species: Hu
Applications: IHC, IHC-P
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
H00166379-B01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-88689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32740
Species: Hu
Applications: WB, IHC, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBL1-12154
Species: Hu
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-15747
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88690
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ICC

Publications for BBS7 Antibody (NBP1-88690) (0)

There are no publications for BBS7 Antibody (NBP1-88690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBS7 Antibody (NBP1-88690) (0)

There are no reviews for BBS7 Antibody (NBP1-88690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BBS7 Antibody (NBP1-88690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BBS7 Products

Bioinformatics Tool for BBS7 Antibody (NBP1-88690)

Discover related pathways, diseases and genes to BBS7 Antibody (NBP1-88690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBS7 Antibody (NBP1-88690)

Discover more about diseases related to BBS7 Antibody (NBP1-88690).
 

Pathways for BBS7 Antibody (NBP1-88690)

View related products by pathway.

Research Areas for BBS7 Antibody (NBP1-88690)

Find related products by research area.

Blogs on BBS7

There are no specific blogs for BBS7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BBS7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BBS7