BATF Antibody (1G4)

Images

 
Western Blot: BATF Antibody (1G4) [H00010538-M03] - Analysis of BATF expression in Raw 264.7 (Cat # L024V1).
Western Blot: BATF Antibody (1G4) [H00010538-M03] - Analysis of BATF expression in PC-12 (Cat # L012V1).
Western Blot: BATF Antibody (1G4) [H00010538-M03] - Analysis of BATF expression in Hela S3 NE (Cat # L013V3).
Western Blot: BATF Antibody (1G4) [H00010538-M03] - Analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M03), clone 1G4. Lane 1: BATF transfected lysatE (14.1 KDa). Lane 2: ...read more
ELISA: BATF Antibody (1G4) [H00010538-M03] - Detection limit for recombinant GST tagged BATF is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
1G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BATF Antibody (1G4) Summary

Immunogen
BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Specificity
BATF (1G4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BATF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using
H00010538-M03 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BATF Antibody (1G4)

  • basic leucine zipper transcription factor, ATF-like
  • BATF
  • BATF1basic leucine zipper transcriptional factor ATF-like
  • B-ATFSFA2
  • B-cell-activating transcription factor
  • SFA2
  • SFA-2activating transcription factor B
  • SF-HT-activated gene 2 protein

Background

The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
594-ML/CF
Species: Mu
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF5525
Species: Hu
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
H00010538-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for BATF Antibody (H00010538-M03)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for BATF Antibody (H00010538-M03) (0)

There are no reviews for BATF Antibody (H00010538-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BATF Antibody (H00010538-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BATF Products

Bioinformatics Tool for BATF Antibody (H00010538-M03)

Discover related pathways, diseases and genes to BATF Antibody (H00010538-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BATF Antibody (H00010538-M03)

Discover more about diseases related to BATF Antibody (H00010538-M03).
 

Pathways for BATF Antibody (H00010538-M03)

View related products by pathway.

PTMs for BATF Antibody (H00010538-M03)

Learn more about PTMs related to BATF Antibody (H00010538-M03).

Blogs on BATF

There are no specific blogs for BATF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BATF Antibody (1G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol BATF
Entrez
Uniprot