BATF Antibody (1G4) - Azide and BSA Free

Western Blot: BATF Antibody (1G4) [H00010538-M03] - Analysis of BATF expression in Raw 264.7 (Cat # L024V1).

Western Blot: BATF Antibody (1G4) [H00010538-M03] - Analysis of BATF expression in PC-12 (Cat # L012V1).

Western Blot: BATF Antibody (1G4) [H00010538-M03] - Analysis of BATF expression in Hela S3 NE (Cat # L013V3).

Western Blot: BATF Antibody (1G4) [H00010538-M03] - Analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M03), clone 1G4. Lane 1: BATF transfected lysatE (14.1 KDa). Lane 2: Non-transfected lysate.

ELISA: BATF Antibody (1G4) [H00010538-M03] - Detection limit for recombinant GST tagged BATF is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 1G4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BATF Antibody (1G4) - Azide and BSA Free Summary

• Immunogen: BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
• Specificity: BATF (1G4)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: BATF
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BATF Antibody (1G4) - Azide and BSA Free

• basic leucine zipper transcription factor, ATF-like
• BATF
• BATF1basic leucine zipper transcriptional factor ATF-like
• B-ATFSFA2
• B-cell-activating transcription factor
• SFA2
• SFA-2activating transcription factor B
• SF-HT-activated gene 2 protein

Background

The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BATF Antibody (H00010538-M03)(2)

Publications using H00010538-M03

• Giunco S, Dolcetti R, Keppel S et al. hTERT Inhibition Triggers Epstein-Barr Virus Lytic Cycle and Apoptosis in Immortalized and Transformed B Cells: A Basis for New Therapies. Clin Cancer Res 2013-04-15 [PMID: 23444223] (WB, Human)
• Wang J, Sun Q, Morita Y et al. A Differentiation Checkpoint Limits Hematopoietic Stem Cell Self-Renewal in Response to DNA Damage. Cell. 2012-03-02 [PMID: 22385964]

Bioinformatics

• Gene Symbol: BATF
• Entrez:
  • 10538(Human)
• Uniprot:
  • NP_006390(Human)