BarX2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BarX2. Source: E. coli Amino Acid Sequence: TSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPPQELPIPSS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
BARX2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57843. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for BarX2 Recombinant Protein Antigen
Background
BARX2 is a member of the Bar class of homeodomain transcription factors. It binds optimally to the DNA consensus sequence YYTAATGRTTTTY. It may control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous system. It may be involved in controlling adhesive processes in keratinizing epithelia. It is highly expressed in adult salivary gland and at much lower levels in mammary gland, kidney and placenta. It contains 1 homeobox DNA-binding domain. BarX2 is a tumour suppressor gene that encodes for a transcription factor known to regulate transcription of cell adhesion molecules in the mouse.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: AC
Publications for BarX2 Recombinant Protein Antigen (NBP2-57843PEP) (0)
There are no publications for BarX2 Recombinant Protein Antigen (NBP2-57843PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BarX2 Recombinant Protein Antigen (NBP2-57843PEP) (0)
There are no reviews for BarX2 Recombinant Protein Antigen (NBP2-57843PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for BarX2 Recombinant Protein Antigen (NBP2-57843PEP) (0)
Additional BarX2 Products
Research Areas for BarX2 Recombinant Protein Antigen (NBP2-57843PEP)
Find related products by research area.
|
Blogs on BarX2