BARD1 Antibody - BSA Free

Immunohistochemistry-Paraffin: BARD1 Antibody [NBP2-47543] - Staining in human testis and liver tissues using anti-BARD1 antibody. Corresponding BARD1 RNA-seq data are presented for the same tissues.

Immunohistochemistry: BARD1 Antibody [NBP2-47543] - Staining of human lateral ventricle shows strong nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: BARD1 Antibody [NBP2-47543] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: BARD1 Antibody [NBP2-47543] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BARD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BARD1 Antibody - BSA Free (NBP2-47543) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MIQLCSKLRNLLHDNELSDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BARD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BARD1 Protein (NBP2-47543PEP)

Reactivity Notes

Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BARD1 Antibody - BSA Free

• BARD-1
• BRCA1 associated RING domain 1
• BRCA1-associated RING domain gene 1
• BRCA1-associated RING domain protein 1
• EC 6.3.2.-

Background

BRCA1-Associated RING Domain gene 1 (BARD1) functions as a tumor suppressor, especially in breast and ovarian cancers. It plays a major role in cancer suppression when it forms a heterodimer with BRCA1. It also plays a role in mediating apoptotic stress and p53-dependent apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BARD1