Band 3 Recombinant Protein Antigen

Images

 
There are currently no images for Band 3 Recombinant Protein Antigen (NBP2-49409PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Band 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Band 3.

Source: E. coli

Amino Acid Sequence: DDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC4A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49409.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Band 3 Recombinant Protein Antigen

  • AE 1
  • AE1MGC126619
  • Anion exchange protein 1
  • Anion exchanger 1
  • band 3 anion transport protein
  • BND3
  • CD233 antigen
  • CD233
  • DI
  • EMPB3
  • EPB3MGC126623
  • erythrocyte membrane protein band 3
  • erythroid anion exchange protein
  • FR
  • Froese blood group
  • MGC116750
  • MGC116753
  • RTA1A
  • Solute carrier family 4 member 1
  • solute carrier family 4, anion exchanger, member 1 (erythrocyte membraneprotein band 3, Diego blood group)
  • solute carrier family 4, anion exchanger, number 1
  • SW
  • Swann blood group
  • Waldner blood group
  • WD
  • WD1
  • WR
  • Wright blood group

Background

The protein encoded by the Band 3 gene is part of the anion exchanger (AE) family and is expressed in the erythrocyte plasma membrane, where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. The encoded protein associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of the exchanger. This protein is predominantly dimeric but forms tetramers in the presence of ankyrin. Many mutations in this gene are known in man, and these mutations can lead to two types of disease: destabilization of red cell membrane leading to hereditary spherocytosis, and defective kidney acid secretion leading to distal renal tubular acidosis. Other mutations that do not give rise to disease result in novel blood group antigens, which form the Diego blood group system. Southeast Asian ovalocytosis (SAO, Melanesian ovalocytosis) results from the heterozygous presence of a deletion in the encoded protein and is common in areas where Plasmodium falciparum malaria is endemic. One null mutation in this gene is known, resulting in very severe anemia and nephrocalcinosis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-83556
Species: Hu
Applications: WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
664-LI
Species: Hu
Applications: BA
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-47405
Species: Hu
Applications: IHC,  IHC-P
NBP2-57496
Species: Hu
Applications: ICC/IF
NBP2-44814
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-84854
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for Band 3 Recombinant Protein Antigen (NBP2-49409PEP) (0)

There are no publications for Band 3 Recombinant Protein Antigen (NBP2-49409PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Band 3 Recombinant Protein Antigen (NBP2-49409PEP) (0)

There are no reviews for Band 3 Recombinant Protein Antigen (NBP2-49409PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Band 3 Recombinant Protein Antigen (NBP2-49409PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Band 3 Products

Research Areas for Band 3 Recombinant Protein Antigen (NBP2-49409PEP)

Find related products by research area.

Blogs on Band 3

There are no specific blogs for Band 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Band 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC4A1