B4GALT4 Antibody

Images

 
Immunohistochemistry-Paraffin: B4GALT4 Antibody [NBP2-14343] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B4GALT4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRG QSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKH LMYLLEHLHPF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B4GALT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
B4GALT4 Protein (NBP2-14343PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B4GALT4 Antibody

  • B4Gal-T4
  • beta-1,4-galactosyltransferase 4
  • Beta-1,4-GalTase 4
  • beta4Gal-T4
  • beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4
  • EC 2.4.1.-
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-88954
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-20024
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88668
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42526
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA, S-ELISA, ELISA(Cap), ELISA(Det)
NBP2-05805
Species: Hu
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-30879
Species: Hu
Applications: IHC, IHC-P
NBP1-85786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for B4GALT4 Antibody (NBP2-14343) (0)

There are no publications for B4GALT4 Antibody (NBP2-14343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALT4 Antibody (NBP2-14343) (0)

There are no reviews for B4GALT4 Antibody (NBP2-14343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for B4GALT4 Antibody (NBP2-14343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B4GALT4 Products

Bioinformatics Tool for B4GALT4 Antibody (NBP2-14343)

Discover related pathways, diseases and genes to B4GALT4 Antibody (NBP2-14343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B4GALT4 Antibody (NBP2-14343)

Discover more about diseases related to B4GALT4 Antibody (NBP2-14343).

Blogs on B4GALT4

There are no specific blogs for B4GALT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B4GALT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT4