B3GNT3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: B3GNT3 Antibody [NBP1-88953] - Staining in human colon and pancreas tissues using anti-B3GNT3 antibody. Corresponding B3GNT3 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: B3GNT3 Antibody [NBP1-88953] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: B3GNT3 Antibody [NBP1-88953] - Staining of human colon shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

B3GNT3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GNT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC reported in scientific literature (PMID: 24998922). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
B3GNT3 Protein (NBP1-88953PEP)
Publications
Read Publications using
NBP1-88953 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24998922).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B3GNT3 Antibody

  • B3GALT8
  • B3GAL-T8
  • B3GNT3
  • B3GN-T3
  • B3GNT-3
  • Beta-1,3-galactosyltransferase 8
  • Beta-1,3-GalTase 8
  • Beta-1,3-Gn-T3
  • Beta-1,3-N-acetylglucosaminyltransferase 3
  • beta-1,3-N-acetylglucosaminyltransferase bGnT-3
  • beta3GalT8
  • Beta3Gal-T8
  • beta3Gn-T3
  • beta-3-Gx-T8
  • BGnT-3
  • Core 1 extending beta-1,3-N-acetylglucosaminyltransferase
  • core1-beta3GlcNAcT
  • EC 2.4.1
  • EC 2.4.1.-
  • HP10328
  • putative type II membrane protein
  • TMEM3
  • TMEM3beta3Gal-T8
  • transmembrane protein 3
  • UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8
  • UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3

Background

B3GNT3 encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for B3GNT3 Antibody (NBP1-88953)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for B3GNT3 Antibody (NBP1-88953) (0)

There are no reviews for B3GNT3 Antibody (NBP1-88953). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for B3GNT3 Antibody (NBP1-88953) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GNT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GNT3