B3GNT3 Antibody

Images

 
Immunohistochemistry: B3GNT3 Antibody [NBP1-88953] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GNT3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GNT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
B3GNT3 Protein (NBP1-88953PEP)
Publications
Read Publication using
NBP1-88953 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24998922).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B3GNT3 Antibody

  • B3GALT8
  • B3GAL-T8
  • B3GN-T3
  • B3GNT-3
  • Beta-1,3-galactosyltransferase 8
  • Beta-1,3-GalTase 8
  • Beta-1,3-Gn-T3
  • Beta-1,3-N-acetylglucosaminyltransferase 3
  • beta-1,3-N-acetylglucosaminyltransferase bGnT-3
  • beta3GalT8
  • Beta3Gal-T8
  • beta3Gn-T3
  • beta-3-Gx-T8
  • BGnT-3
  • Core 1 extending beta-1,3-N-acetylglucosaminyltransferase
  • core1-beta3GlcNAcT
  • EC 2.4.1
  • EC 2.4.1.-
  • HP10328
  • putative type II membrane protein
  • TMEM3beta3Gal-T8
  • transmembrane protein 3
  • UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8
  • UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8
  • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2030
Species: Hu
Applications: WB, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP2-45527
Species: Hu
Applications: WB, IHC, IF
NB100-56536
Species: Hu
Applications: Flow, IHC, IHC-P, Flow-CS, Flow-IC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-92566
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NBP1-86921
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
AF8519
Species: Hu, Mu, Rt
Applications: WB
AF2795
Species: Hu
Applications: WB
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC

Publications for B3GNT3 Antibody (NBP1-88953)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for B3GNT3 Antibody (NBP1-88953) (0)

There are no reviews for B3GNT3 Antibody (NBP1-88953). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for B3GNT3 Antibody (NBP1-88953) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GNT3 Products

Bioinformatics Tool for B3GNT3 Antibody (NBP1-88953)

Discover related pathways, diseases and genes to B3GNT3 Antibody (NBP1-88953). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GNT3 Antibody (NBP1-88953)

Discover more about diseases related to B3GNT3 Antibody (NBP1-88953).
 

Pathways for B3GNT3 Antibody (NBP1-88953)

View related products by pathway.

Blogs on B3GNT3

There are no specific blogs for B3GNT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GNT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GNT3