B3GALNT1 Antibody

Images

 
Western Blot: B3GALNT1 Antibody [NBP1-74240] - Rat Muscle Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GALNT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of B3galnt1. Immunizing peptide sequence FTGYPLIENYSYRGFFHKNHISYQEYPFKVFPPYCSGLGYIMSGDLVPKI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GALNT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against B3galnt1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B3GALNT1 Antibody

  • b3Gal-T3
  • Beta-1,3-galactosyltransferase 3
  • Beta-1,3-GalNAc-T1
  • Beta-1,3-GalTase 3
  • beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)
  • beta3GalT3
  • Beta3Gal-T3
  • beta-3-Gx-T3
  • brainiac1
  • EC 2.4.1.79
  • Galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase
  • Gb4Cer
  • GLCT3
  • Globoside synthase
  • globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase
  • P antigen synthase
  • P blood group globoside
  • P
  • polypeptide 3 (Globosideblood group)
  • UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
  • UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group)
  • UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group)
  • UDP-N-acetylgalactosamine:globotriaosylceramidebeta-1,3-N-acetylgalactosaminyltransferase

Background

B3galnt1 transfers N-acetylgalactosamine onto globotriaosylceramide.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74240
Species: Rt
Applications: WB

Publications for B3GALNT1 Antibody (NBP1-74240) (0)

There are no publications for B3GALNT1 Antibody (NBP1-74240).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALNT1 Antibody (NBP1-74240) (0)

There are no reviews for B3GALNT1 Antibody (NBP1-74240). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALNT1 Antibody (NBP1-74240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GALNT1 Products

Bioinformatics Tool for B3GALNT1 Antibody (NBP1-74240)

Discover related pathways, diseases and genes to B3GALNT1 Antibody (NBP1-74240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on B3GALNT1

There are no specific blogs for B3GALNT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GALNT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GALNT1
Uniprot