B-Raf Recombinant Protein Antigen

Images

 
There are currently no images for B-Raf Recombinant Protein Antigen (NBP2-58818PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

B-Raf Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human B-Raf.

Source: E. coli

Amino Acid Sequence: ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BRAF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58818.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for B-Raf Recombinant Protein Antigen

  • 94 kDa B-raf protein
  • B-Raf proto-oncogene serine/threonine-protein kinase (p94)
  • BRaf
  • B-Raf
  • BRAF1
  • B-RAF1
  • BRAF1MGC126806
  • EC 2.7.11.1
  • MGC138284
  • murine sarcoma viral (v-raf) oncogene homolog B1
  • NS7
  • p94
  • Proto-oncogene B-Raf
  • RAFB1
  • serine/threonine-protein kinase B-raf
  • v-raf murine sarcoma viral oncogene homolog B1FLJ95109

Background

B-Raf, also know as c-Rmil, is a Serine/Threonine protein kinase member of the Raf family which includes Raf-1 and A-Raf. B-Raf is involved in the transduction of mitogenic signals from the cell membrane to the nucleus (1). Composed of three conserved region (CR1, CR2, CR3) B-Raf is expressed primarily in the brain and in the nervous system (2). It has been observed that MAPK is activated by B-Raf in response to nerve growth factor (3). More than 60% of malignant melanomas were found to contain a specific mutation, B-Raf (V599E) the product of which possesses constitutive kinase activity (4). Mutations in B-Raf have also been identified in lung cancer and non-Hodgkin lymphoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF482
Species: Mu
Applications: IHC, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-16473
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB41051
Species: Hu, Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-33711
Species: Hu
Applications: IHC,  IHC-P
NBP2-43792
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for B-Raf Recombinant Protein Antigen (NBP2-58818PEP) (0)

There are no publications for B-Raf Recombinant Protein Antigen (NBP2-58818PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B-Raf Recombinant Protein Antigen (NBP2-58818PEP) (0)

There are no reviews for B-Raf Recombinant Protein Antigen (NBP2-58818PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for B-Raf Recombinant Protein Antigen (NBP2-58818PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B-Raf Products

Research Areas for B-Raf Recombinant Protein Antigen (NBP2-58818PEP)

Find related products by research area.

Blogs on B-Raf.

Autophagy and RAS signaling: Clinical implications
By Christina Towers, PhD The cellular recycling process known as autophagy is currently being targeted in over 60 clinical trials focused on treating different types of cancer1. To date, the only autophagy-targeted ...  Read full blog post.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

You can't be without me - SNF5
The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our B-Raf Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BRAF