AWAT1 Antibody - Azide and BSA Free Summary
| Immunogen |
DGAT2L3 (AAI53035.1, 1 a.a. - 328 a.a.) full-length human protein. MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
AWAT1 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for AWAT1 Antibody - Azide and BSA Free
Background
The protein encoded by the AWAT1 gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax)alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting thatthis enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein ispredominantly expressed in the sebaceous gland of the skin. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, KO, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, KD
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: BA
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Dr, Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: WB
Publications for AWAT1 Antibody (H00158833-B01P) (0)
There are no publications for AWAT1 Antibody (H00158833-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AWAT1 Antibody (H00158833-B01P) (0)
There are no reviews for AWAT1 Antibody (H00158833-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AWAT1 Antibody (H00158833-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AWAT1 Products
Blogs on AWAT1