AVEN Antibody (2B10)

Images

 
Western Blot: AVEN Antibody (2B10) [H00057099-M08] - Analysis of AVEN expression in Jurkat (Cat # L017V1).
Western Blot: AVEN Antibody (2B10) [H00057099-M08] - Analysis of AVEN expression in PC-12 (Cat # L012V1).
Western Blot: AVEN Antibody (2B10) [H00057099-M08] - Analysis of AVEN expression in NIH/3T3 (Cat # L018V1).
Sandwich ELISA: AVEN Antibody (2B10) [H00057099-M08] - Detection limit for recombinant GST tagged AVEN is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AVEN Antibody (2B10) Summary

Immunogen
AVEN (NP_065104.1, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCP
Specificity
AVEN - apoptosis, caspase activation inhibitor (2B10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AVEN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AVEN Antibody (2B10)

  • apoptosis, caspase activation inhibitor
  • cell death regulator Aven
  • PDCD12
  • programmed cell death 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
MAB868
Species: Hu
Applications: WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
H00000875-M01
Species: Ba, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB100-1992
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MEP00B
Species: Mu
Applications: ELISA
NB100-481
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NB100-2289
Species: Gp, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NB100-757
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
H00136541-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Publications for AVEN Antibody (H00057099-M08) (0)

There are no publications for AVEN Antibody (H00057099-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AVEN Antibody (H00057099-M08) (0)

There are no reviews for AVEN Antibody (H00057099-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AVEN Antibody (H00057099-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AVEN Products

Array H00057099-M08

Bioinformatics Tool for AVEN Antibody (H00057099-M08)

Discover related pathways, diseases and genes to AVEN Antibody (H00057099-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AVEN Antibody (H00057099-M08)

Discover more about diseases related to AVEN Antibody (H00057099-M08).
 

Pathways for AVEN Antibody (H00057099-M08)

View related products by pathway.

PTMs for AVEN Antibody (H00057099-M08)

Learn more about PTMs related to AVEN Antibody (H00057099-M08).
 

Research Areas for AVEN Antibody (H00057099-M08)

Find related products by research area.

Blogs on AVEN

There are no specific blogs for AVEN, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AVEN Antibody (2B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol AVEN
Entrez
Uniprot