Aurora C Antibody

Images

 
Western Blot: Aurora C Antibody [H00006795-B01P] - Analysis of AURKC expression in transfected 293T cell line by AURKC polyclonal antibody. Lane 1: AURKC transfected lysate(33.99 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Aurora C Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
AURKC (NP_001015878.1, 1 a.a. - 309 a.a.) full-length human protein. MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS
Specificity
AURKC - aurora kinase C,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
AURKC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aurora C Antibody

  • AIE2
  • AIE2AIK3
  • AIK3
  • AIRK3
  • ARK3
  • ARK-3
  • ARK3Serine/threonine-protein kinase aurora-C
  • AurC
  • AURKC
  • Aurora 3
  • Aurora C
  • aurora kinase CAurora/IPL1/Eg2 protein 2
  • Aurora/IPL1-related kinase 3
  • aurora-C
  • Aurora-related kinase 3
  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 13 (aurora/IPL1-like)
  • serine/threonine-protein kinase 13
  • STK13
  • STK13ARK-3

Background

This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NBP1-79984
Species: Hu
Applications: WB
NB110-85519
Species: Mu
Applications: ELISA, IHC, IP, KD, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
H00009266-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP3-12270
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-17923
Species: Hu
Applications: IHC, IHC-P
NBP2-84247
Species: Hu
Applications: WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
DY884B
Species: Hu
Applications: ELISA
NBP3-13389
Species: Hu
Applications: IHC, IHC-P, WB
H00006795-B01P
Species: Hu
Applications: WB

Publications for Aurora C Antibody (H00006795-B01P) (0)

There are no publications for Aurora C Antibody (H00006795-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aurora C Antibody (H00006795-B01P) (0)

There are no reviews for Aurora C Antibody (H00006795-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aurora C Antibody (H00006795-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aurora C Products

Diseases for Aurora C Antibody (H00006795-B01P)

Discover more about diseases related to Aurora C Antibody (H00006795-B01P).
 

Pathways for Aurora C Antibody (H00006795-B01P)

View related products by pathway.

PTMs for Aurora C Antibody (H00006795-B01P)

Learn more about PTMs related to Aurora C Antibody (H00006795-B01P).
 

Research Areas for Aurora C Antibody (H00006795-B01P)

Find related products by research area.

Blogs on Aurora C

There are no specific blogs for Aurora C, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aurora C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AURKC
Entrez
Uniprot