aurora A-binding protein Antibody

Images

 
Western Blot: aurora A-binding protein Antibody [NBP1-81152] - Analysis in control (vector only transfected HEK293T lysate) and AUNIP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunocytochemistry/ Immunofluorescence: aurora A-binding protein Antibody [NBP1-81152] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: aurora A-binding protein Antibody [NBP1-81152] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.

Product Details

Summary
Reactivity Hu, V-ViSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

aurora A-binding protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CGVWLDAAALKRRKVQTHLIKPGTKMLTLLPGERKANIYFTQRRAPSTGIHQRSIASFFTLQPGKTNGSDQTSVSSHTESQIN
Specificity
Specificity of human aurora A-binding protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AUNIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Knockdown validation (PMID: 31964734).
Control Peptide
aurora A-binding protein Protein (NBP1-81152PEP)
Publications
Read Publication using
NBP1-81152 in the following applications:

  • KD
    1 publication
  • WB
    1 publication

Reactivity Notes

Virus reactivity reported in scientific literature (PMID:31964734).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for aurora A-binding protein Antibody

  • AIBP
  • aurora A-binding protein
  • chromosome 1 open reading frame 135
  • FLJ14264
  • MGC2603

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93990
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-94504
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-93202
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-83483
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37243
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-62516
Species: Hu
Applications: WB
NBP1-46853
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81646
Species: Hu
Applications: IHC, IHC-P
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-82857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75520
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-92630
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27293
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for aurora A-binding protein Antibody (NBP1-81152)(1)

We have publications tested in 1 confirmed species: Virus.

We have publications tested in 2 applications: KD, WB.


Filter By Application
KD
(1)
WB
(1)
All Applications
Filter By Species
Virus
(1)
All Species

Reviews for aurora A-binding protein Antibody (NBP1-81152) (0)

There are no reviews for aurora A-binding protein Antibody (NBP1-81152). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for aurora A-binding protein Antibody (NBP1-81152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional aurora A-binding protein Products

Bioinformatics Tool for aurora A-binding protein Antibody (NBP1-81152)

Discover related pathways, diseases and genes to aurora A-binding protein Antibody (NBP1-81152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on aurora A-binding protein

There are no specific blogs for aurora A-binding protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our aurora A-binding protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AUNIP
Entrez