aurora A-binding protein Antibody

Images

 
Western Blot: aurora A-binding protein Antibody [NBP1-81152] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: aurora A-binding protein Antibody [NBP1-81152] - Staining of human cell line U-251MG shows positivity in centrosome.
Immunohistochemistry-Paraffin: aurora A-binding protein Antibody [NBP1-81152] - Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

aurora A-binding protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CGVWLDAAALKRRKVQTHLIKPGTKMLTLLPGERKANIYFTQRRAPSTGIHQRSIASFFTLQPGKTNGSDQTSVSSHTESQIN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AUNIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
aurora A-binding protein Protein (NBP1-81152PEP)

Alternate Names for aurora A-binding protein Antibody

  • AIBP
  • aurora A-binding protein
  • chromosome 1 open reading frame 135
  • FLJ14264
  • MGC2603

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80805
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC
NBP2-13620
Species: Hu
Applications: IHC, IHC-P
NB100-91724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83483
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06986
Species: Hu, Mu, Rt
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA
NBP1-87916
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81645
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7007
Species: Mu
Applications: WB, IHC
H00000292-B01P
Species: Hu
Applications: WB, ELISA
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF

Publications for aurora A-binding protein Antibody (NBP1-81152) (0)

There are no publications for aurora A-binding protein Antibody (NBP1-81152).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for aurora A-binding protein Antibody (NBP1-81152) (0)

There are no reviews for aurora A-binding protein Antibody (NBP1-81152). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for aurora A-binding protein Antibody (NBP1-81152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional aurora A-binding protein Antibody Products

Related Products by Gene

Bioinformatics Tool for aurora A-binding protein Antibody (NBP1-81152)

Discover related pathways, diseases and genes to aurora A-binding protein Antibody (NBP1-81152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on aurora A-binding protein

There are no specific blogs for aurora A-binding protein, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol AUNIP

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81152 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought