aurora A-binding protein Antibody (NBP1-81152)

Images

 
Western Blot: aurora A-binding protein Antibody [NBP1-81152] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: aurora A-binding protein Antibody [NBP1-81152] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry-Paraffin: aurora A-binding protein Antibody [NBP1-81152] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

aurora A-binding protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CGVWLDAAALKRRKVQTHLIKPGTKMLTLLPGERKANIYFTQRRAPSTGIHQRSIASFFTLQPGKTNGSDQTSVSSHTESQIN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AUNIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
aurora A-binding protein Protein (NBP1-81152PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for aurora A-binding protein Antibody

  • AIBP
  • aurora A-binding protein
  • chromosome 1 open reading frame 135
  • FLJ14264
  • MGC2603

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-13620
Species: Hu
Applications: IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-83483
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06986
Species: Hu, Mu, Rt
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA
NBP1-87916
Species: Hu
Applications: IHC, IHC-P
NBP1-46853
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81645
Species: Hu
Applications: IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7007
Species: Mu
Applications: WB, IHC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF

Publications for aurora A-binding protein Antibody (NBP1-81152) (0)

There are no publications for aurora A-binding protein Antibody (NBP1-81152).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for aurora A-binding protein Antibody (NBP1-81152) (0)

There are no reviews for aurora A-binding protein Antibody (NBP1-81152). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for aurora A-binding protein Antibody (NBP1-81152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional aurora A-binding protein Antibody Products

Related Products by Gene

Bioinformatics Tool for aurora A-binding protein Antibody (NBP1-81152)

Discover related pathways, diseases and genes to aurora A-binding protein Antibody (NBP1-81152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on aurora A-binding protein

There are no specific blogs for aurora A-binding protein, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our aurora A-binding protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AUNIP

Customers Who Bought This Also Bought