FLJ10769 Antibody

Images

 
Western Blot: FLJ10769 Antibody [NBP1-62516] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FLJ10769 Antibody [NBP1-62516] - Jurkat, Antibody Dilution: 1.0 ug/ml CARKD is supported by BioGPS gene expression data to be expressed in Jurkat.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FLJ10769 Antibody Summary

Immunogen
Synthetic peptides corresponding to CARKD (carbohydrate kinase domain containing) The peptide sequence was selected from the middle region of CARKD. Peptide sequence RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (92%), Equine (100%), Bovine (100%), Guinea Pig (100%), Rabbit (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CARKD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FLJ10769 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FLJ10769 Antibody

  • carbohydrate kinase domain containing
  • carbohydrate kinase domain-containing protein
  • FLJ10769
  • FLJ34548
  • FLJ52550
  • LP3298

Background

The exact function of FLJ10769 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-83483
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81152
Species: Hu, V-Vi
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-75520
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-62516
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for FLJ10769 Antibody (NBP1-62516) (0)

There are no publications for FLJ10769 Antibody (NBP1-62516).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ10769 Antibody (NBP1-62516) (0)

There are no reviews for FLJ10769 Antibody (NBP1-62516). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FLJ10769 Antibody (NBP1-62516) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FLJ10769 Products

Bioinformatics Tool for FLJ10769 Antibody (NBP1-62516)

Discover related pathways, diseases and genes to FLJ10769 Antibody (NBP1-62516). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLJ10769 Antibody (NBP1-62516)

Discover more about diseases related to FLJ10769 Antibody (NBP1-62516).

Blogs on FLJ10769

There are no specific blogs for FLJ10769, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLJ10769 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CARKD