AUF1 Recombinant Protein Antigen

Images

 
There are currently no images for AUF1 Protein (NBP1-88915PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AUF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPD.

Source: E. coli

Amino Acid Sequence: RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HNRNPD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88915.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AUF1 Recombinant Protein Antigen

  • AUF1A
  • heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein1, 37kDa)
  • heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein1, 37kD)
  • heterogeneous nuclear ribonucleoprotein D0
  • hnRNPD0
  • type A

Background

hnRNP D/AUF1 binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3' untranslated regions of many protooncogenes and cytokine mRNAs. It also binds to double and single stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single stranded nonmonotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. It may be involved in translationally coupled mRNA turnover (referenced from swissprot).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
H00001994-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
409-ML
Species: Mu
Applications: BA
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-49142
Species: Hu
Applications: IHC, IHC-P, KD, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-82580
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

Publications for AUF1 Protein (NBP1-88915PEP) (0)

There are no publications for AUF1 Protein (NBP1-88915PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AUF1 Protein (NBP1-88915PEP) (0)

There are no reviews for AUF1 Protein (NBP1-88915PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AUF1 Protein (NBP1-88915PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AUF1 Products

Research Areas for AUF1 Protein (NBP1-88915PEP)

Find related products by research area.

Blogs on AUF1.

Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD)
Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm.  Transportin 1 is co...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AUF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPD