Atrial Natriuretic Peptide/ANP Antibody - BSA Free

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073] - Analysis in human heart muscle and duodenum tissues using Anti-NPPA antibody. Corresponding NPPA RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073] - Staining of human duodenum shows low expression as expected.

Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP3-17073] - Staining of human heart muscle shows high expression.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Atrial Natriuretic Peptide/ANP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNS
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPPA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

• ANF
• ANP
• ANPatriopeptin
• ATFB6
• atrial natriuretic factor
• Atrial Natriuretic Peptide
• Cardionatrin
• CDD-ANF
• natriuretic peptide A
• natriuretic peptide precursor A
• NPPA
• PND
• PNDcardionatrin
• prepronatriodilatin

Background

Atrial natriuretic factor (ANP) is a potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis and has a cGMP stimulating activity. There are two different prepronatriodilatin alleles. One codes for 2 Arginine residues at the C terminus that are cleaved to form the mature peptide, while the other ends in a termination codon immediately after the last codon of the mature peptide. ANP belongs to the natriuretic peptide family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPPA