We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human ATR GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ATR Protein [H00000545-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related ATR Peptides and Proteins

Order Details


    • Catalog Number
      H00000545-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ATR GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2545-2644 of Human ATR

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATR GST (N-Term) Protein

  • ataxia telangiectasia and Rad3 related
  • Ataxia telangiectasia and Rad3-related protein
  • ATR
  • EC 2.7.11.1
  • FRAP-related protein 1
  • FRP1
  • FRP1FRAP-related protein-1
  • MEC1
  • protein kinase ATR
  • Rad3 related protein
  • SCKL1
  • SCKLMEC1, mitosis entry checkpoint 1, homolog
  • serine/threonine-protein kinase ATR

Background

ATR - ataxia telangiectasia and Rad3 related

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-56546
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
NBP2-24457
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NB100-658
Species: Hu
Applications: IP, KD, WB
NBP1-80695
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NB120-13600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-247
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-02004
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-304
Species: Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
NB100-56155
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00000545-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for ATR Partial Recombinant Protein (H00000545-Q01) (0)

There are no publications for ATR Partial Recombinant Protein (H00000545-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATR Partial Recombinant Protein (H00000545-Q01) (0)

There are no reviews for ATR Partial Recombinant Protein (H00000545-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATR Partial Recombinant Protein (H00000545-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATR Products

Array H00000545-Q01

Research Areas for ATR Partial Recombinant Protein (H00000545-Q01)

Find related products by research area.

Blogs on ATR.

Further unraveling the role of gamma H2AX in DNA damage response
Our genome experiences a moderate amount of DNA damage in our cells on a daily basis.  This DNA damage can be in response to external environmental factors, or be a result of our internal metabolic processes going awry.  While normal rates of DNA ...  Read full blog post.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATR GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATR