ATPase Antibody

Images

 
Immunohistochemistry: ATPase Antibody [NBP1-89709] - Staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATPase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAH8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATPase Protein (NBP1-89709PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATPase Antibody

  • ATPase
  • axonemal
  • dynein, axonemal, heavy chain 8
  • dynein, axonemal, heavy polypeptide 8
  • FLJ25850
  • FLJ36115
  • FLJ36334
  • hdhc9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP2-02000
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
AF5055
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1519
Species: Hu
Applications: WB, IHC
NBP2-32432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92041
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4499
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-89709
Species: Hu
Applications: IHC, IHC-P

Publications for ATPase Antibody (NBP1-89709) (0)

There are no publications for ATPase Antibody (NBP1-89709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATPase Antibody (NBP1-89709) (0)

There are no reviews for ATPase Antibody (NBP1-89709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATPase Antibody (NBP1-89709). (Showing 1 - 4 of 4 FAQ).

  1. I have phosphate in my enzyme. What can I do?
    • You can dialyse or desalt the enzyme into a phosphate-free buffer. Alternatively, you can use a special resin (PiBind) to remove the phosphate.
  2. I have 5% DMSO in my assay. Can I use PiColorLock Gold?
    • Yes, the reagent is designed for drug screening work and other situations that require DMSO.
  3. I have a high background in my ATPase assay and I definitely do not have free phosphate in my sample
    • This is almost always due to inadequate mixing of the special stabilizer with the sample and detection reagent. Make sure the stabilizer is pipetted up and down several times to ensure thorough mixing.
  4. I would like to measure the conversion of pyrophosphate to phosphate. Can I use the PiColorLock Gold Phosphate Detection System for this purpose?
    • Yes, only the phosphate will give a signal; pyrophosphate will not.

Secondary Antibodies

 

Isotype Controls

Additional ATPase Products

Bioinformatics Tool for ATPase Antibody (NBP1-89709)

Discover related pathways, diseases and genes to ATPase Antibody (NBP1-89709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATPase Antibody (NBP1-89709)

Discover more about diseases related to ATPase Antibody (NBP1-89709).
 

Pathways for ATPase Antibody (NBP1-89709)

View related products by pathway.

Research Areas for ATPase Antibody (NBP1-89709)

Find related products by research area.

Blogs on ATPase

There are no specific blogs for ATPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATPase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAH8