ATP6V1C1 Antibody - BSA Free

Images

 
Western Blot: ATP6V1C1 Antibody [NBP1-54902] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

ATP6V1C1 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to ATP6V1C1(ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1) The peptide sequence was selected from the N terminal of ATP6V1C1. Peptide sequence ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: C 1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V1C1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for ATP6V1C1 Antibody - BSA Free

  • ATP6CH+-transporting ATPase chain C, vacuolar
  • ATP6Dsubunit C of vacuolar proton-ATPase V1 domain
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
  • FLJ20057
  • H(+)-transporting two-sector ATPase, subunit C
  • vacuolar ATP synthase subunit C
  • vacuolar proton pump C subunit
  • Vacuolar proton pump subunit C 1
  • vacuolar proton pump, 42-kD subunit
  • vacuolar proton-ATPase, subunit C, VI domain
  • VATCH+ -ATPase C subunit
  • V-ATPase C subunit
  • V-ATPase subunit C 1
  • Vma5
  • V-type proton ATPase subunit C 1

Background

ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-00580
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88890
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-49059
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP2-83943
Species: Rt
Applications: WB
NBP2-15520
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-47916
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
H00008992-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-88894
Species: Hu
Applications: IHC, IHC-P
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
NBP2-46556
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-31600
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-54902
Species: Hu
Applications: WB

Publications for ATP6V1C1 Antibody (NBP1-54902) (0)

There are no publications for ATP6V1C1 Antibody (NBP1-54902).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1C1 Antibody (NBP1-54902) (0)

There are no reviews for ATP6V1C1 Antibody (NBP1-54902). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V1C1 Antibody (NBP1-54902) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V1C1 Products

Research Areas for ATP6V1C1 Antibody (NBP1-54902)

Find related products by research area.

Blogs on ATP6V1C1

There are no specific blogs for ATP6V1C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1C1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1C1
Uniprot