ATP6V1A Recombinant Protein Antigen

Images

 
There are currently no images for ATP6V1A Recombinant Protein Antigen (NBP2-55164PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATP6V1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to ATP6V1A.

Source: E. coli

Amino Acid Sequence: YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP6V1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55164.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP6V1A Recombinant Protein Antigen

  • 70kD, isoform 1
  • ATP6A1
  • ATP6V1A
  • ATP6V1A1
  • ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide
  • ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A
  • EC 3.6.3
  • EC 3.6.3.14
  • EC 7.1.2.2
  • H(+)-transporting two-sector ATPase, subunit A
  • H+-transporting ATPase chain A, vacuolar (VA68 type)
  • HO68
  • VA68
  • vacuolar ATP synthase catalytic subunit A, ubiquitous isoform
  • Vacuolar ATPase isoform VA68
  • vacuolar proton pump alpha subunit 1
  • Vacuolar proton pump subunit alpha
  • V-ATPase 69 kDa subunit 1
  • V-ATPase 69 kDa subunit
  • V-ATPase A subunit 1
  • V-ATPase subunit A
  • Vma1
  • VPP2
  • V-type proton ATPase catalytic subunit A

Background

ATP6V1A encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89330
Species: Hu
Applications: IHC,  IHC-P
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88890
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-00580
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
AF1049
Species: Hu
Applications: IHC, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-31600
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-48671
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
NBP2-55164PEP
Species: Hu
Applications: AC

Publications for ATP6V1A Recombinant Protein Antigen (NBP2-55164PEP) (0)

There are no publications for ATP6V1A Recombinant Protein Antigen (NBP2-55164PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1A Recombinant Protein Antigen (NBP2-55164PEP) (0)

There are no reviews for ATP6V1A Recombinant Protein Antigen (NBP2-55164PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATP6V1A Recombinant Protein Antigen (NBP2-55164PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP6V1A Products

Blogs on ATP6V1A

There are no specific blogs for ATP6V1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP6V1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1A