ATP6V0D2 Antibody


Western Blot: ATP6V0D2 Antibody [NBP1-54595] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ATP6V0D2 Antibody Summary

Synthetic peptides corresponding to ATP6V0D2(ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2) The peptide sequence was selected from the middle region of ATP6V0D2. Peptide sequence GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
This product is specific to Subunit or Isoform: d 2.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ATP6V0D2 and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP6V0D2 Antibody

  • ATP6D2
  • ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
  • FLJ38708
  • Vacuolar proton pump subunit d 2
  • V-ATPase subunit d 2
  • VMA6
  • V-type proton ATPase subunit d 2


ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow

Publications for ATP6V0D2 Antibody (NBP1-54595) (0)

There are no publications for ATP6V0D2 Antibody (NBP1-54595).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V0D2 Antibody (NBP1-54595) (0)

There are no reviews for ATP6V0D2 Antibody (NBP1-54595). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V0D2 Antibody (NBP1-54595) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ATP6V0D2 Antibody (NBP1-54595)

Discover related pathways, diseases and genes to ATP6V0D2 Antibody (NBP1-54595). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0D2 Antibody (NBP1-54595)

Discover more about diseases related to ATP6V0D2 Antibody (NBP1-54595).

Pathways for ATP6V0D2 Antibody (NBP1-54595)

View related products by pathway.

PTMs for ATP6V0D2 Antibody (NBP1-54595)

Learn more about PTMs related to ATP6V0D2 Antibody (NBP1-54595).

Blogs on ATP6V0D2

There are no specific blogs for ATP6V0D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP6V0D2 Antibody and receive a gift card or discount.


Gene Symbol ATP6V0D2