The lack of CD73 leads to increased osteoclastogenesis in vitro. (A) Osteoclast differentiation model in the presence of M-CSF and RANKL. (B) Protein expression with the respective (C) densitometry analysis of CD73 ...read more
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to ATP6V0D2(ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2) The peptide sequence was selected from the middle region of ATP6V0D2. Peptide sequence GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: d 2.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0D2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-54595 in the following applications:
ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our ATP6V0D2 Antibody - BSA Free and receive a gift card or discount.