ATP6V0D1 Antibody - BSA Free

Western Blot: ATP6V0D1 Antibody [NBP1-88893] - Analysis in human cell line MCF-7.

Immunohistochemistry-Paraffin: ATP6V0D1 Antibody [NBP1-88893] - Staining of human kidney shows distinct positivity in extracellular material.

Western Blot: ATP6V0D1 Antibody [NBP1-88893] - Analysis in control (vector only transfected HEK293T lysate) and ATP6V0D1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP6V0D1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATP6V0D1 Antibody - BSA Free (NBP1-88893) is a polyclonal antibody validated for use in IHC and WB. Anti-ATP6V0D1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKL
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V0D1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ATP6V0D1 Recombinant Protein Antigen (NBP1-88893PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP6V0D1 Antibody - BSA Free

• 32 kDa accessory protein
• ATP6D
• ATP6DV
• ATP6V0
• ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D
• ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1
• ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
• FLJ43534
• H(+)-transporting two-sector ATPase, subunit D
• P39
• Vacuolar proton pump subunit d 1
• V-ATPase 40 kDa accessory protein
• V-ATPase AC39 subunit
• V-ATPase, subunit D
• VATX
• Vma6
• VPATPDV-ATPase subunit d 1
• V-type proton ATPase subunit d 1

Background

ATP6V0D1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP6V0D1 Antibody (NBP1-88893)(1)

Publication using NBP1-88893

• Akwa Y, Di Malta C, Zallo F et al. Stimulation of synaptic activity promotes TFEB-mediated clearance of pathological MAPT/Tau in cellular and mouse models of tauopathies Autophagy 2022-07-22 [PMID: 35867714] (WB, IF/IHC, Human, Mouse)

Bioinformatics

• Gene Symbol: ATP6V0D1