ATP6V0D1 Antibody

Images

 
Western Blot: ATP6V0D1 Antibody [NBP1-88893] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: ATP6V0D1 Antibody [NBP1-88893] - Staining of human kidney shows distinct positivity in extracellular material.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V0D1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP6V0D1 Protein (NBP1-88893PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V0D1 Antibody

  • 32 kDa accessory protein
  • ATP6D
  • ATP6DV
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
  • FLJ43534
  • H(+)-transporting two-sector ATPase, subunit D
  • P39
  • Vacuolar proton pump subunit d 1
  • V-ATPase 40 kDa accessory protein
  • V-ATPase AC39 subunit
  • V-ATPase, subunit D
  • VATX
  • Vma6
  • VPATPDV-ATPase subunit d 1
  • V-type proton ATPase subunit d 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF2428
Species: Hu
Applications: WB
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-83193
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP6V0D1 Antibody (NBP1-88893) (0)

There are no publications for ATP6V0D1 Antibody (NBP1-88893).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V0D1 Antibody (NBP1-88893) (0)

There are no reviews for ATP6V0D1 Antibody (NBP1-88893). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V0D1 Antibody (NBP1-88893) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V0D1 Products

Bioinformatics Tool for ATP6V0D1 Antibody (NBP1-88893)

Discover related pathways, diseases and genes to ATP6V0D1 Antibody (NBP1-88893). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0D1 Antibody (NBP1-88893)

Discover more about diseases related to ATP6V0D1 Antibody (NBP1-88893).
 

Pathways for ATP6V0D1 Antibody (NBP1-88893)

View related products by pathway.

Blogs on ATP6V0D1

There are no specific blogs for ATP6V0D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V0D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V0D1