ATP6V0D1 Antibody (2G12)

Images

 
Western Blot: ATP6V0D1 Antibody (2G12) [H00009114-M01] - ATP6V0D1 monoclonal antibody (M01), clone 2G12 Analysis of ATP6V0D1 expression in HeLa.
Immunohistochemistry-Paraffin: ATP6V0D1 Antibody (2G12) [H00009114-M01] - Analysis of monoclonal antibody to ATP6V0D1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 0.5 ug/ml.
Western Blot: ATP6V0D1 Antibody (2G12) [H00009114-M01] - Analysis of ATP6V0D1 expression in transfected 293T cell line by ATP6V0D1 monoclonal antibody (M01), clone 2G12.Lane 1: ATP6V0D1 transfected lysate(40.3 KDa).Lane ...read more
Sandwich ELISA: ATP6V0D1 Antibody (2G12) [H00009114-M01] - Detection limit for recombinant GST tagged ATP6V0D1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
2G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATP6V0D1 Antibody (2G12) Summary

Immunogen
ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN
Specificity
ATP6V0D1 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP6V0D1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publication using H00009114-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V0D1 Antibody (2G12)

  • 32 kDa accessory protein
  • ATP6D
  • ATP6DV
  • ATP6V0
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1
  • ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
  • FLJ43534
  • H(+)-transporting two-sector ATPase, subunit D
  • P39
  • Vacuolar proton pump subunit d 1
  • V-ATPase 40 kDa accessory protein
  • V-ATPase AC39 subunit
  • V-ATPase, subunit D
  • VATX
  • Vma6
  • VPATPDV-ATPase subunit d 1
  • V-type proton ATPase subunit d 1

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-23485
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF2428
Species: Hu
Applications: WB
NBP1-92564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
419-ML/CF
Species: Mu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31650
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DY1857
Species: Mu
Applications: ELISA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-67719
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
DRT100
Species: Hu
Applications: ELISA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ATP6V0D1 Antibody (H00009114-M01)(1)

Reviews for ATP6V0D1 Antibody (H00009114-M01) (0)

There are no reviews for ATP6V0D1 Antibody (H00009114-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V0D1 Antibody (H00009114-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V0D1 Products

Bioinformatics Tool for ATP6V0D1 Antibody (H00009114-M01)

Discover related pathways, diseases and genes to ATP6V0D1 Antibody (H00009114-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0D1 Antibody (H00009114-M01)

Discover more about diseases related to ATP6V0D1 Antibody (H00009114-M01).
 

Pathways for ATP6V0D1 Antibody (H00009114-M01)

View related products by pathway.

Blogs on ATP6V0D1

There are no specific blogs for ATP6V0D1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V0D1 Antibody (2G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V0D1
Entrez
OMIM
Uniprot