ATP6V0B Antibody

Images

 
Western Blot: ATP6V0B Antibody [H00000533-D01P] - Analysis of ATP6V0B expression in transfected 293T cell line by ATP6V0B polyclonal antibody.Lane 1: ATP6V0B transfected lysate(21.40 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V0B Antibody Summary

Immunogen
ATP6V0B (NP_004038.1, 1 a.a. - 205 a.a.) full-length human protein. MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V0B
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V0B Antibody

  • ATP6FH(+)-transporting two-sector ATPase, subunit F
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) 21kD
  • ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b
  • ATPase, H+ transporting, lysosomal 21kDa, V0 subunit c''
  • HATPL
  • vacuolar ATP synthase 21 kDa proteolipid subunit
  • Vacuolar proton pump 21 kDa proteolipid subunit
  • vacuolar proton pump, 21 kDa subunit
  • V-ATPase 21 kDa proteolipid subunit
  • V-ATPase subunit c''
  • VMA16
  • V-type proton ATPase 21 kDa proteolipid subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-59654
Species: Hu
Applications: WB
NBP1-88891
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00028299-P01
Species: Hu
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-81639
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83257
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48251
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55232
Species: Hu
Applications: WB, ICC/IF
NBP1-54376
Species: Hu
Applications: WB, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03498
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009114-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38512
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000533-D01P
Species: Hu
Applications: WB

Publications for ATP6V0B Antibody (H00000533-D01P) (0)

There are no publications for ATP6V0B Antibody (H00000533-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V0B Antibody (H00000533-D01P) (0)

There are no reviews for ATP6V0B Antibody (H00000533-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP6V0B Antibody (H00000533-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V0B Products

Bioinformatics Tool for ATP6V0B Antibody (H00000533-D01P)

Discover related pathways, diseases and genes to ATP6V0B Antibody (H00000533-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V0B Antibody (H00000533-D01P)

Discover more about diseases related to ATP6V0B Antibody (H00000533-D01P).
 

Pathways for ATP6V0B Antibody (H00000533-D01P)

View related products by pathway.

PTMs for ATP6V0B Antibody (H00000533-D01P)

Learn more about PTMs related to ATP6V0B Antibody (H00000533-D01P).

Blogs on ATP6V0B

There are no specific blogs for ATP6V0B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V0B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V0B
Uniprot