ATP6V0A1 Antibody - BSA Free

Western Blot: ATP6V0A1 Antibody [NBP2-87054] - WB Suggested Anti-Atp6v0a1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Mouse Uterus

Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP2-87054] - Sample Type: A. untransfected HeLa cells B. mATP6V0A1 transfected HeLa cells. Primary Antibody Dilution: 1:250. Secondary Antibody: Anti-rabbit AlexaFluor 488. Secondary Antibody Dilution: 1:1000. Color/Signal Descriptions: Atp6v0a1: Green DAPI:Blue. Gene Name: Atp6v0a1 . Submitted by: Anonymous

Western Blot: ATP6V0A1 Antibody [NBP2-87054] - Host: Rabbit. Target Name: Atp6v0a1. Sample Tissue: Human DLD1 Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: ATP6V0A1 Antibody [NBP2-87054] - Host: Rabbit. Target Name: Atp6v0a1. Sample Tissue: Mouse Mouse Skeletal Muscle. Antibody Dilution: 1ug/ml

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATP6V0A1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse ATP6V0A1. Peptide sequence: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V0A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP6V0A1 Antibody - BSA Free

• a1
• ATP6N1
• ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD)
• ATP6V0
• ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD)
• ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
• ATPase, H+ transporting, lysosomal V0 subunit a1
• Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
• DKFZp781J1951
• Stv1
• Vacuolar adenosine triphosphatase subunit Ac116
• Vacuolar proton pump subunit 1
• vacuolar proton pump, subunit 1
• Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
• vacuolar proton translocating ATPase 116 kDa subunit A
• vacuolar-type H(+)-ATPase 115 kDa subunit
• V-ATPase 116 kDa isoform a1
• V-ATPase 116 kDa
• Vph1
• VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1
• V-type proton ATPase 116 kDa subunit a isoform 1
• V-type proton ATPase 116 kDa subunit a

Background

ATP6V0A1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V0A1