ATP5J Antibody (2F4)

Images

 
Sandwich ELISA: ATP5J Antibody (2F4) [H00000522-M02] - Detection limit for recombinant GST tagged ATP5J is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATP5J Antibody (2F4) Summary

Immunogen
ATP5J (AAH01178, 1 a.a. - 108 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
Specificity
ATP5J - ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 (2F4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP5J
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP5J Antibody (2F4)

  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6
  • ATP5
  • ATP5A
  • ATPase subunit F6
  • ATPM
  • coupling factor 6
  • F6
  • mitochondrial ATP synthase, coupling factor 6
  • mitochondrial ATP synthase, subunit F6
  • mitochondrial ATPase coupling factor 6
  • mitochondrial
  • proliferation-inducing protein 36

Background

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the F0 complex, required for F1 and F0 interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-46555
Species: Hu
Applications: WB, IHC
AF2338
Species: Hu
Applications: WB, IP, ICC
NBP1-59168
Species: Hu
Applications: WB
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P

Publications for ATP5J Antibody (H00000522-M02) (0)

There are no publications for ATP5J Antibody (H00000522-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5J Antibody (H00000522-M02) (0)

There are no reviews for ATP5J Antibody (H00000522-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5J Antibody (H00000522-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5J Products

Bioinformatics Tool for ATP5J Antibody (H00000522-M02)

Discover related pathways, diseases and genes to ATP5J Antibody (H00000522-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5J Antibody (H00000522-M02)

Discover more about diseases related to ATP5J Antibody (H00000522-M02).
 

Pathways for ATP5J Antibody (H00000522-M02)

View related products by pathway.

Research Areas for ATP5J Antibody (H00000522-M02)

Find related products by research area.

Blogs on ATP5J

There are no specific blogs for ATP5J, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5J Antibody (2F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5J
Entrez
Uniprot