ATP5I Antibody - Azide and BSA Free

Western Blot: ATP5I Antibody [NBP3-04766] - Analysis of extracts of various cell lines, using ATP5I antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunocytochemistry/Immunofluorescence: ATP5I Antibody [NBP3-04766] - Analysis of U-2 OS cells using ATP5I antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: ATP5I Antibody [NBP3-04766] - Paraffin-embedded human stomach using ATP5I antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP5I Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ATP5I Antibody - Azide and BSA Free (NBP3-04766) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human ATP5I (NP_009031.1). MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5ME
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
• Theoretical MW: 7 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ATP5I Antibody - Azide and BSA Free

• ATP synthase e chain, mitochondrial
• ATP synthase subunit e, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E
• ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E
• ATP5K
• ATPase subunit e
• F1F0-ATP synthase, murine e subunit
• MGC12532

Background

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the innermembrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalyticcore, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a singlerepresentative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodesthe e subunit of the F0 complex. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ATP5ME