ATP5G2 Antibody


Immunohistochemistry-Paraffin: ATP5G2 Antibody [NBP2-14331] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ATP5G2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLK RPEILTDESLSSLAVSCPLTSLVSSRSFQ
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP5G2 Protein (NBP2-14331PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ATP5G2 Antibody

  • ATP synthase lipid-binding protein, mitochondrial
  • ATP synthase proteolipid P2
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9)
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
  • ATPase protein 9
  • ATPase subunit c
  • isoform 2
  • mitochondrial ATP synthase, subunit C (subunit 9)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Mu
Applications: Bind
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for ATP5G2 Antibody (NBP2-14331) (0)

There are no publications for ATP5G2 Antibody (NBP2-14331).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5G2 Antibody (NBP2-14331) (0)

There are no reviews for ATP5G2 Antibody (NBP2-14331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP5G2 Antibody (NBP2-14331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ATP5G2 Products

Bioinformatics Tool for ATP5G2 Antibody (NBP2-14331)

Discover related pathways, diseases and genes to ATP5G2 Antibody (NBP2-14331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5G2 Antibody (NBP2-14331)

Discover more about diseases related to ATP5G2 Antibody (NBP2-14331).

Pathways for ATP5G2 Antibody (NBP2-14331)

View related products by pathway.

PTMs for ATP5G2 Antibody (NBP2-14331)

Learn more about PTMs related to ATP5G2 Antibody (NBP2-14331).

Blogs on ATP5G2

There are no specific blogs for ATP5G2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP5G2 Antibody and receive a gift card or discount.


Gene Symbol ATP5G2