ATP5G2 Antibody

Images

 
Immunohistochemistry-Paraffin: ATP5G2 Antibody [NBP2-14331] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP5G2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLK RPEILTDESLSSLAVSCPLTSLVSSRSFQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP5G2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP5G2 Protein (NBP2-14331PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP5G2 Antibody

  • ATP synthase lipid-binding protein, mitochondrial
  • ATP synthase proteolipid P2
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9)
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
  • ATPase protein 9
  • ATPase subunit c
  • isoform 2
  • mitochondrial ATP synthase, subunit C (subunit 9)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43782
Species: Hu
Applications: WB
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-42805
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5629
Species: Hu, Mu
Applications: WB
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
640-A3
Species: Mu
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS

Publications for ATP5G2 Antibody (NBP2-14331) (0)

There are no publications for ATP5G2 Antibody (NBP2-14331).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5G2 Antibody (NBP2-14331) (0)

There are no reviews for ATP5G2 Antibody (NBP2-14331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP5G2 Antibody (NBP2-14331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5G2 Products

Bioinformatics Tool for ATP5G2 Antibody (NBP2-14331)

Discover related pathways, diseases and genes to ATP5G2 Antibody (NBP2-14331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5G2 Antibody (NBP2-14331)

Discover more about diseases related to ATP5G2 Antibody (NBP2-14331).
 

Pathways for ATP5G2 Antibody (NBP2-14331)

View related products by pathway.

PTMs for ATP5G2 Antibody (NBP2-14331)

Learn more about PTMs related to ATP5G2 Antibody (NBP2-14331).

Blogs on ATP5G2

There are no specific blogs for ATP5G2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5G2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5G2