ATP13A2 Antibody

Images

 
Immunohistochemistry: ATP13A2 Antibody [NBP2-49149] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP13A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIET
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP13A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP13A2 Recombinant Protein Antigen (NBP2-49149PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP13A2 Antibody

  • ATPase type 13A2
  • EC 3.6.3
  • EC 3.6.3.-
  • EC 3.6.3.5
  • EC 3.6.3.8
  • FLJ26510
  • HSA9947
  • KRPPD
  • PARK9putative ATPase
  • Parkinson disease (autosomal recessive) 9 (Kufor-Rakeb syndrome)
  • probable cation-transporting ATPase 13A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-270
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
BC100-494
Species: Dr, Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
NB300-268
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
H00025793-B01P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002629-M01
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF1438
Species: Hu
Applications: IHC, WB
H00008398-D01P
Species: Hu, Mu
Applications: WB
NB600-1160
Species: Bv, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
AF1458
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NB120-11433
Species: Hu, Pm, Mu, Rt, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
NBP2-22217
Species: Ch, Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP3-05529
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-76990
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-49149
Species: Hu
Applications: IHC, IHC-P

Publications for ATP13A2 Antibody (NBP2-49149) (0)

There are no publications for ATP13A2 Antibody (NBP2-49149).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP13A2 Antibody (NBP2-49149) (0)

There are no reviews for ATP13A2 Antibody (NBP2-49149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP13A2 Antibody (NBP2-49149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP13A2 Products

Bioinformatics Tool for ATP13A2 Antibody (NBP2-49149)

Discover related pathways, diseases and genes to ATP13A2 Antibody (NBP2-49149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP13A2 Antibody (NBP2-49149)

Discover more about diseases related to ATP13A2 Antibody (NBP2-49149).
 

Pathways for ATP13A2 Antibody (NBP2-49149)

View related products by pathway.

PTMs for ATP13A2 Antibody (NBP2-49149)

Learn more about PTMs related to ATP13A2 Antibody (NBP2-49149).
 

Research Areas for ATP13A2 Antibody (NBP2-49149)

Find related products by research area.

Blogs on ATP13A2

There are no specific blogs for ATP13A2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP13A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP13A2