ATP11C Antibody

Images

 
Western Blot: ATP11C Antibody [NBP1-69062] - Mouse Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP11C Antibody Summary

Immunogen
Synthetic peptides corresponding to Atp11c (ATPase, class VI, type 11C) The peptide sequence was selected from the C terminal of Atp11c. Peptide sequence GLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP11C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Atp11c and was validated on Western blot.
Theoretical MW
129 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP11C Antibody

  • ATPase IQ
  • ATPase, class VI, type 11C
  • ATPIGprobable phospholipid-transporting ATPase IG
  • ATPIQATPase class VI type 11C
  • EC 3.6.3
  • EC 3.6.3.1
  • phospholipid-transporting ATPase IG

Background

The function of Atp11c remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77189
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
AF2569
Species: Hu
Applications: WB, ICC
NBP1-77190
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IF
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-30403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00004168-B01P-50ug
Species: Hu
Applications: WB
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF3369
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-90840
Species: Hu
Applications: IHC, IHC-P
NB100-1392
Species: Hu
Applications: WB, PEP-ELISA
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88905
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86739
Species: Hu
Applications: IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5165
Species: Hu, Mu
Applications: WB
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP1-69062
Species: Mu
Applications: WB

Publications for ATP11C Antibody (NBP1-69062) (0)

There are no publications for ATP11C Antibody (NBP1-69062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP11C Antibody (NBP1-69062) (0)

There are no reviews for ATP11C Antibody (NBP1-69062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP11C Antibody (NBP1-69062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP11C Products

Bioinformatics Tool for ATP11C Antibody (NBP1-69062)

Discover related pathways, diseases and genes to ATP11C Antibody (NBP1-69062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP11C Antibody (NBP1-69062)

Discover more about diseases related to ATP11C Antibody (NBP1-69062).
 

Pathways for ATP11C Antibody (NBP1-69062)

View related products by pathway.

Blogs on ATP11C

There are no specific blogs for ATP11C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP11C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP11C
Uniprot