ATP10D Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATP10D Antibody [NBP2-14327] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: ATP10D Antibody [NBP2-14327] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP10D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFPSPILRAKHFDRLTPEERTKALKKWRGAGKMNQVTSKYANQSAGKSGR RPMPGPSAVFAMKSASSCAIEQGNLSLCETALDQGYSETKAFEMAGPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP10D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP10D Protein (NBP2-14327PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP10D Antibody

  • ATPase, class V, type 10D
  • ATPVDtype IV aminophospholipid transporting ATPase
  • EC 3.6.3
  • EC 3.6.3.1
  • KIAA1487ATPase class V type 10D
  • probable phospholipid-transporting ATPase VD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
NBP2-30403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-77189
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
NBP2-14617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP2-05627
Species: Hu
NBP1-90840
Species: Hu
Applications: IHC, IHC-P
NBP1-88902
Species: Hu
Applications: IHC, IHC-P
NBP2-33418
Species: Hu
Applications: WB, IHC, IHC-P
H00079603-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88905
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86739
Species: Hu
Applications: IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-60150
Species: Hu, Mu, Rt
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP2-13303
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31576
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
46770002
Species: Hu
Applications: ELISA

Publications for ATP10D Antibody (NBP2-14327) (0)

There are no publications for ATP10D Antibody (NBP2-14327).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP10D Antibody (NBP2-14327) (0)

There are no reviews for ATP10D Antibody (NBP2-14327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATP10D Antibody (NBP2-14327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP10D Products

Bioinformatics Tool for ATP10D Antibody (NBP2-14327)

Discover related pathways, diseases and genes to ATP10D Antibody (NBP2-14327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP10D Antibody (NBP2-14327)

Discover more about diseases related to ATP10D Antibody (NBP2-14327).
 

Pathways for ATP10D Antibody (NBP2-14327)

View related products by pathway.

Blogs on ATP10D

There are no specific blogs for ATP10D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP10D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP10D