ATP10D Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ATP10D Antibody [NBP2-14327] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & plasma membrane.

Immunohistochemistry-Paraffin: ATP10D Antibody [NBP2-14327] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP10D Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LFPSPILRAKHFDRLTPEERTKALKKWRGAGKMNQVTSKYANQSAGKSGRRPMPGPSAVFAMKSASSCAIEQGNLSLCETALDQGYSETKAFEMAGPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP10D
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATP10D Protein (NBP2-14327PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP10D Antibody - BSA Free

• ATPase, class V, type 10D
• ATPVDtype IV aminophospholipid transporting ATPase
• EC 3.6.3
• EC 3.6.3.1
• KIAA1487ATPase class V type 10D
• probable phospholipid-transporting ATPase VD

Background

ATP10D is a gene that codes for a protein that is expressed in the placenta and is 1426 amino acids long, weighs approximately 160 kDa, and has a shorter isoform that is 1231 amino acids long and weighs approximately 139 kDa. Current research is being done on diseases and disorders related to this gene including pharyngitis. ATP10D has also been shown to have interactions with ARFGEF1, ATPA1, LARS, PAPD5, and TMED2 in pathways such as the ion channel transport and small molecule transmembrane transport pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP10D