ATP10D Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATP10D Antibody [NBP2-14327] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: ATP10D Antibody [NBP2-14327] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP10D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LFPSPILRAKHFDRLTPEERTKALKKWRGAGKMNQVTSKYANQSAGKSGRRPMPGPSAVFAMKSASSCAIEQGNLSLCETALDQGYSETKAFEMAGPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP10D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP10D Protein (NBP2-14327PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP10D Antibody

  • ATPase, class V, type 10D
  • ATPVDtype IV aminophospholipid transporting ATPase
  • EC 3.6.3
  • EC 3.6.3.1
  • KIAA1487ATPase class V type 10D
  • probable phospholipid-transporting ATPase VD

Background

ATP10D is a gene that codes for a protein that is expressed in the placenta and is 1426 amino acids long, weighs approximately 160 kDa, and has a shorter isoform that is 1231 amino acids long and weighs approximately 139 kDa. Current research is being done on diseases and disorders related to this gene including pharyngitis. ATP10D has also been shown to have interactions with ARFGEF1, ATPA1, LARS, PAPD5, and TMED2 in pathways such as the ion channel transport and small molecule transmembrane transport pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
NBP2-30403
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13169
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-88903
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-81883
Species: Hu
Applications: ELISA, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-05627
Species: Hu
Applications: WB
H00023120-B01P-50ug
Species: Hu
Applications: WB
H00286410-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-33418
Species: Hu
Applications: IHC, IHC-P
H00079603-M03
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-88905
Species: Hu
Applications: IHC, IHC-P
NBP1-59474
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP1-60150
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, WB
H00201780-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-91353
Species: Hu, Mu
Applications: WB
NBP2-26211
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP1-90068
Species: Hu
Applications: IHC, IHC-P

Publications for ATP10D Antibody (NBP2-14327) (0)

There are no publications for ATP10D Antibody (NBP2-14327).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP10D Antibody (NBP2-14327) (0)

There are no reviews for ATP10D Antibody (NBP2-14327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATP10D Antibody (NBP2-14327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP10D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP10D