SPTLC3 Antibody

Images

 
Western Blot: SPTLC3 Antibody [NBP2-33418] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SPTLC3 Antibody [NBP2-33418] - Staining in human epididymis and pancreas tissues using anti-SPTLC3 antibody. Corresponding SPTLC3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPTLC3 Antibody [NBP2-33418] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SPTLC3 Antibody [NBP2-33418] - Staining of human epididymis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPTLC3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVF
Specificity
Specificity of human SPTLC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPTLC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPTLC3 Protein (NBP2-33418PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPTLC3 Antibody

  • C20orf38
  • Chromosome 20 Open Reading Frame 38
  • dJ718P11
  • EC 2.3.1.50
  • hLCB2b
  • LCB 3
  • LCB2B
  • LCB3
  • Long Chain Base Biosynthesis Protein 2b
  • Long Chain Base Biosynthesis Protein 3
  • Serine Palmitoyltransferase 3
  • Serine Palmitoyltransferase, Long Chain Base Subunit 2-Like (Aminotransferase 2)
  • Serine Palmitoyltransferase, Long Chain Base Subunit 3
  • Serine-Palmitoyl-CoA Transferase 3
  • SPT 3
  • SPT3
  • SPTLC2L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57507
Species: Hu
Applications: ICC/IF
NBP2-58076
Species: Hu
Applications: ICC/IF
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
MAB2695
Species: Hu
Applications: WB
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-59643
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33582
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
NBP1-56629
Species: Hu
Applications: WB
NBP2-57414
Species: Hu
Applications: ICC/IF
NBP2-20308
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-55408
Species: Hu
Applications: WB, ICC/IF
NBP2-16760
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76279
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SPTLC3 Antibody (NBP2-33418) (0)

There are no publications for SPTLC3 Antibody (NBP2-33418).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPTLC3 Antibody (NBP2-33418) (0)

There are no reviews for SPTLC3 Antibody (NBP2-33418). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPTLC3 Antibody (NBP2-33418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SPTLC3 Antibody (NBP2-33418)

Discover related pathways, diseases and genes to SPTLC3 Antibody (NBP2-33418). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPTLC3 Antibody (NBP2-33418)

Discover more about diseases related to SPTLC3 Antibody (NBP2-33418).

Blogs on SPTLC3

There are no specific blogs for SPTLC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPTLC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTLC3
Uniprot