ATP10D Antibody

Images

 
Western Blot: ATP10D Antibody [NBP1-69111] - Rat Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP10D Antibody Summary

Immunogen
Synthetic peptides corresponding to Atp10d (ATPase, class V, type 10D) The peptide sequence was selected from the middle region of Atp10d. Peptide sequence YAKRGLRTLCVAKKVMSDTEYAEWLRNHFLAETSIDNREELLVESAMRLE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP10D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Atp10d and was validated on Western blot.
Theoretical MW
153 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP10D Antibody

  • ATPase, class V, type 10D
  • ATPVDtype IV aminophospholipid transporting ATPase
  • EC 3.6.3
  • EC 3.6.3.1
  • KIAA1487ATPase class V type 10D
  • probable phospholipid-transporting ATPase VD

Background

The function of Atp10d remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
NBP2-30403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-77189
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
NBP2-14617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP2-05627
Species: Hu
NBP1-90840
Species: Hu
Applications: IHC, IHC-P
NBP1-88902
Species: Hu
Applications: IHC, IHC-P
NBP2-33418
Species: Hu
Applications: WB, IHC, IHC-P
H00079603-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88905
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86739
Species: Hu
Applications: IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-60150
Species: Hu, Mu, Rt
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP2-13303
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31576
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
46770002
Species: Hu
Applications: ELISA

Publications for ATP10D Antibody (NBP1-69111) (0)

There are no publications for ATP10D Antibody (NBP1-69111).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP10D Antibody (NBP1-69111) (0)

There are no reviews for ATP10D Antibody (NBP1-69111). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP10D Antibody (NBP1-69111) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP10D Products

Bioinformatics Tool for ATP10D Antibody (NBP1-69111)

Discover related pathways, diseases and genes to ATP10D Antibody (NBP1-69111). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP10D Antibody (NBP1-69111)

Discover more about diseases related to ATP10D Antibody (NBP1-69111).
 

Pathways for ATP10D Antibody (NBP1-69111)

View related products by pathway.

Blogs on ATP10D

There are no specific blogs for ATP10D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP10D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP10D