ATOX1 Antibody - BSA Free

Western Blot: ATOX1 Antibody [NBP2-92669] - Analysis of extracts of various cell lines, using ATOX1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 15s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATOX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATOX1 Antibody - BSA Free (NBP2-92669) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human ATOX1 (NP_004036.1). MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATOX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 7 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATOX1 Antibody - BSA Free

• ATX1 (antioxidant protein 1, yeast) homolog 1
• ATX1 antioxidant protein 1 homolog (yeast)
• ATX1
• copper transport protein ATOX1
• HAH1 MGC138453
• hah1
• Metal transport protein ATX1
• MGC138455

Background

ATOX1 is a ubiquitously expressed copper chaperone that supports copper homeostasis by transporting cytosolic copper to ATPase proteins in the trans-Golgi network, where they can then be incorporated to the ceruloplasmin. ATOX 1 is also thought to function as an antioxidant against superoxide and hydrogen peroxide, and therefore plays an important role in carcinogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATOX1